Login Become an Insider

Features

  • BevNET Live
  • Best of 2024 Awards
  • Spirits Awards
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • Content Calendar
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Best of 2025 Awards
      Submit Your Nominations
    • Spirit Awards 2025
      Submit Your Nominations
    • Community Call Topics
      Submit Questions & Topics for Future Calls
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Community Call
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2023 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
    • Supplier Finder
      Database of Suppliers & Service Providers
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Community Call
      Pressing Topics Impacting Businesses
    • Elevator Talk
      Watch Emerging Brands Pitch
    • Category Close-Up
      Dive into Major Food & Beverage Categories
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
Our Family of Brands
nosh brewbound taste-radionombase
  • BevNET Live
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Our Family of Brands
nosh brewbound taste-radionombase
  • Login
  • Account image
    User Icon
  • Subscription:
    Manage Account Sign Out
  • close Subscribe
    Sign In
Become an Insider
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

B.R. Distilling Company Launches Limited-Release Blue Note Special Reserve

info_outline PRESS RELEASE posted by Blue Note Bourbon

Feb. 10, 2025 at 10:39 am

X LinkedIn Reddit Facebook Email
Report Press Release
bourbonbourbonwhiskeybluenotebourbonspecialreservecaskfinishedserieslimitedrelease
Spirits Companies
  • image-01

Blend of Straight Bourbon Whiskeys Finished in 10 Different Casks is the Latest Expression in the Company’s Cask Finished Series

Memphis, TN (February 10, 2025) – Blue Note Bourbon™, the award-winning whiskey portfolio which is artfully crafted to honor the rich blues music that is synonymous with Memphis, has launched its second-annual Special Reserve Straight Bourbon Whiskey.

Crafted in Memphis, the limited-release is a blend of 10 casks from Kentucky and Tennessee – cognac, madeira, sherry, port, triple sec, madeira, apricot brandy, amontillado, vanilla cognac and vino de Naranja – ranging in age from four to 19 years with varying mashbills. The new expression was bottled at 116.3 proof (58.15% ABV), unfiltered.

Special Reserve Tasting Notes

·       Nose: Bright fruit, cherry, peach, leather, oak and vanilla

·       Palate: Creamy and light, oak, vanilla, roasted nuts, dark chocolate, and citrus

·       Finish: Light warmth with a chewy, slightly dry texture that lingers

In addition to last year’s Special Reserve, Blue Note has introduced several other highly awarded limited-release offerings, which include Premium Small Batch, Single Barrel Reserve, 17-year, and most recently a Honey Rye and Honey Bourbon Cask.

“Having launched several wildly successful limited releases in recent years, whiskey enthusiasts have come to expect these types of unique offerings from Blue Note,” said Chris Crosbie, Vice President, Sales, B.R. Distilling Company. “This year’s Special Reserve is both exceptional and uncommon having been crafted from 10 unique types of casks.”

Approximately 2,000 bottles of Blue Note Special Reserve are now available for purchase online at BlueNoteBourbon.com and in 20 U.S. states (as listed below). The suggested retail price for a 750ml bottle is $225.

Blue Note’s whiskey portfolio is distilled in partnership with Bardstown Bourbon Company (parent company of Green River Distilling) and then aged just north of downtown Memphis where the Mississippi and Wolf Rivers collide. The long summers filled with infamous Memphis heat and cooler evenings forces the whiskey deep into the oak, creating an unmistakably rich flavor that’s bold yet smooth.

In addition to the aforementioned limited releases, award-winning flagship Blue Note portfolio includes Juke Joint ($34.99), Crossroads ($44.99), Uncut ($49.99), and Straight Rye Whiskey ($34.99). At the 2024 San Francisco World Spirits Competition, Juke Joint and Crossroads were awarded Platinum medals, a rare honor meaning that each expression has received Double Gold medals for three consecutive years.

Production Facility & Tasting Room

Blue Note’s 110,000 square foot production facilities, located on Royal Avenue just North of downtown Memphis, are open from Monday through Friday from 10am – 4:00pm CST and include a unique and intimate tasting room. Guided tours are available on Thursdays and Fridays for $10 plus tax & fees. Guests can add a Tasting Flight Experience for an additional $5. Please follow Blue Note on Facebook and Instagram.

About B.R. Distilling Company

Founded in 2014 in Memphis, TN, B.R. Distilling Company is the oldest licensed distillery in Memphis, TN, and producer of world-famous Blue Note Bourbon. Currently, the company produces four flagship expressions, along with regular limited releases, which are distributed across 20 U.S. states, including AL, AR, CO, CT, FL, GA, KS, KY, LA, MA, MI, MS, MO, NY, NJ, OK, RI, SC, TN, and TX, and online at BlueNoteBourbon.com via Bevstack, which can be shipped to: AZ, CA, CO, CT, DE, FL, GA, IA, ID, IL, IN, KS, KY, MD, MN, MO, NC, ND, NE, NH, NJ, NM, NV, NY, OH, OK, OR, PA, RI, TX, VA, WA and WI. Take note. Sip responsibly.

# # #

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

RNDC CEO Bob Hendrickson has Died

RNDC CEO Bob Hendrickson has Died

Global Flavors and ‘Female Rage’ Fuel Union Kitchen Event

Global Flavors and ‘Female Rage’ Fuel Union Kitchen Event

Modern Iced Tea Brands Look To Flavor, Packaging To Enter C-Stores

Modern Iced Tea Brands Look To Flavor, Packaging To Enter C-Stores

SPONSORED POST
The Agency Fueling Explosive Amazon Growth for Beverage & CPG Brands

The Agency Fueling Explosive Amazon Growth for Beverage & CPG Brands

Marketplace

Co-Packing or Contract at Summit Brewing

Co-Packing or Contract at Summit Brewing

View All|Post a Listing

Featured Jobs

Sales Manager - Westbound & Down Brewing Company

Sales Manager - Westbound & Down Brewing Company

Area Sales Manager/Merchandiser Southern California - Cascadia Managing Brands

Area Sales Manager/Merchandiser Southern Califo...

Senior Director Product Innovation - King Arthur Baking Company

Senior Director Product Innovation - King Arthu...

DFW Brewery Representative  - Saint Arnold Brewing Company

DFW Brewery Representative - Saint Arnold Brew...

On Premise Sales Rep - Philadelphia - Two Robbers Spirits Co.

On Premise Sales Rep - Philadelphia - Two Robbe...

Packaging & Quality Manager - Aloha Beer Co.

Packaging & Quality Manager - Aloha Beer Co.

View All Jobs|Post a Job

More News

NACS: Packaging Innovation Reshapes Water At C-Stores

NACS: Packaging Innovation Reshapes Water At C-Stores

Pepsi Preps To Lean into Protein, Back Off Artificial Ingredients in 2026

Pepsi Preps To Lean into Protein, Back Off Artificial Ingredients in 2026

New Products: Uncle Matt’s Does Yerba Mate, Seasonals From Laird and Sylva

New Products: Uncle Matt’s Does Yerba Mate, Seasonals From Laird and Sylva

Taste Radio: Is THC In Target A Tipping Point? Finally, Fiber Is Sexy.

Taste Radio: Is THC In Target A Tipping Point? Finally, Fiber Is Sexy.

Beverage Industry Jobs

  • Business Development Manager - Dora's Naturals - Dora's Naturals
  • Director of Operations - Lamplighter Brewing Co. - Lamplighter Brewing Co.
  • Tea Sommelier - Rishi Tea & Botanicals - Rishi Tea & Botanicals
  • Sales Manager - Westbound & Down Brewing Company - Westbound & Down Brewing Company
  • General Manager - Tap House - Brewery Ommegang - Brewery Ommegang
  • Brand Manager-Northwest NJ - Kane Brewing Company - Kane Brewing Company
  • Brewery Production Teammate - Cool Crafted Beverage - Cool Crafted Beverage
View All|Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. RNDC CEO Bob Hendrickson has Died
  2. Global Flavors and ‘Female Rage’ Fuel Union Kitchen Event
  3. Modern Iced Tea Brands Look To Flavor, Packaging To Enter C-Stores
  4. NACS: Packaging Innovation Reshapes Water At C-Stores
  5. Pepsi Preps To Lean into Protein, Back Off Artificial Ingredients in 2026
  6. New Products: Uncle Matt’s Does Yerba Mate, Seasonals From Laird and Sylva
  7. Taste Radio: Is THC In Target A Tipping Point? Finally, Fiber Is Sexy.
  1. The Salty and poppi Partner on a Nostalgic Root Beer Float-Inspired Menu
  2. Three Chord Bourbon Unleashes Vol 2, a New Look That Underscores Its Roots in Music
  3. Foursquare Rum Distillery Launches Mark XXIX Mandamus Rum
  4. Whiskey JYPSI Toasts 250 Years of American Independence with "The Declaration"
  5. Brause Expands Southern California Distribution Through Foundation Foods, Launches in Mother’s Market & Kitchen
  6. Brice Bezin Becomes Cellar Master of Maison Telmont to Carry Forward the Project 'In the Name of Mother Nature'
  7. Hop Zombie the 13th at Lone Tree Brewing
  1. A Drink With… Devon Trevathan, Nomadic Distiller and Co-Founder of Liba Spirits
  2. Kylie Jenner’s Sprinter Brand Raises $4M
  3. A Drink With… Colin Asare-Appiah, Mixologist and Bacardi Trade Director of Culture and Lifestyle
  4. The Zero Proof Playbook: Ben Branson On The Future Of Socializing
  5. The Phony Negroni Built Its Brand In Bars, What’s Next?
  6. New RTDs From BuzzBallz, Jack Daniel’s and New York Cocktail Company
  7. US Spirits Exports Decline 9% Amid Trade Tensions
  1. RNDC CEO Robert Hendrickson has Died
  2. Molson Coors to Eliminate 400 Jobs By End of December
  3. Tariff Turmoil: How Import Beer’s Growth Driver Turned into a Loss Leader
  4. Duvel Eyes 15% Share of Belgian Imports in 2026
  5. Insider’s Week in Beer: 👋 Send Your Wine Friends a Beer
  6. NBWA Panel: ‘Facts, Not Fearmongering’ Can Help Beer Beat Headwinds
  7. Constellation Beer President Jim Sabia: ‘We Will Get Out of This, I Truly Believe It’
View All|Submit News

Promoted PR Posts

Sierra Nevada Brewing Company Selects Ohanafy to Power 2026 National Wholesaler Incentive Program

Sierra Nevada Brewing Company Selects Ohanafy to Power 2026 National Wholesaler Incentive Program

Felene Vodka Expands to Pacific Northwest with Key Distribution Partner

Felene Vodka Expands to Pacific Northwest with Key Distribution Partner

Rupee Beer Debuts First-Of Its Kind Indian Non-Alcoholic Beer

Rupee Beer Debuts First-Of Its Kind Indian Non-Alcoholic Beer

Chef Ming Tsai Named Hospitality Ambassador for Double Cross Vodka

Chef Ming Tsai Named Hospitality Ambassador for Double Cross Vodka

Left Coast Brewing Company Wins Gold Medal at Great American Beer Festival

Left Coast Brewing Company Wins Gold Medal at Great American Beer Festival

Confido Acquires Muffin Data to Expand Analytics Capabilities for CPG Brands

Confido Acquires Muffin Data to Expand Analytics Capabilities for CPG Brands

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
© 1996 – 2025 BevNET.com® Terms of Use Privacy Policy
Back
03/11: Introducing...Nombase! 03/13: Expo West Roundup: Standout Products & Trends from Key Decision Makers 03/20: Growing at Retail: What Does Smart Growth Look Like? 03/27: Smart Demos, Steady Growth. A Cost-Effective Strategy for Retail.
View Community Call Calendar
An error has occurred. This application may no longer respond until reloaded. Reload 🗙