• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Sign Out Manage Account
Sign Out User Short Name
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live
  • Best of 2024 Awards
  • Spirits Awards
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • Content Calendar
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Best of 2025 Awards
      Submit Your Nominations
    • Spirit Awards 2025
      Submit Your Nominations
    • Community Call Topics
      Submit Questions & Topics for Future Calls
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Community Call
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2023 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
    • Supplier Finder
      Database of Suppliers & Service Providers
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Community Call
      Pressing Topics Impacting Businesses
    • Elevator Talk
      Watch Emerging Brands Pitch
    • Category Close-Up
      Dive into Major Food & Beverage Categories
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

B.R. Distilling Company Launches Limited-Release Blue Note Special Reserve

info_outline PRESS RELEASE posted by Blue Note Bourbon

Feb. 10, 2025 at 10:39 am

X LinkedIn Reddit Facebook Email
Report Press Release
bourbonbourbonwhiskeybluenotebourbonspecialreservecaskfinishedserieslimitedrelease
Spirits Companies
  • image-01

Blend of Straight Bourbon Whiskeys Finished in 10 Different Casks is the Latest Expression in the Company’s Cask Finished Series

Memphis, TN (February 10, 2025) – Blue Note Bourbon™, the award-winning whiskey portfolio which is artfully crafted to honor the rich blues music that is synonymous with Memphis, has launched its second-annual Special Reserve Straight Bourbon Whiskey.

Crafted in Memphis, the limited-release is a blend of 10 casks from Kentucky and Tennessee – cognac, madeira, sherry, port, triple sec, madeira, apricot brandy, amontillado, vanilla cognac and vino de Naranja – ranging in age from four to 19 years with varying mashbills. The new expression was bottled at 116.3 proof (58.15% ABV), unfiltered.

Special Reserve Tasting Notes

·       Nose: Bright fruit, cherry, peach, leather, oak and vanilla

·       Palate: Creamy and light, oak, vanilla, roasted nuts, dark chocolate, and citrus

·       Finish: Light warmth with a chewy, slightly dry texture that lingers

In addition to last year’s Special Reserve, Blue Note has introduced several other highly awarded limited-release offerings, which include Premium Small Batch, Single Barrel Reserve, 17-year, and most recently a Honey Rye and Honey Bourbon Cask.

“Having launched several wildly successful limited releases in recent years, whiskey enthusiasts have come to expect these types of unique offerings from Blue Note,” said Chris Crosbie, Vice President, Sales, B.R. Distilling Company. “This year’s Special Reserve is both exceptional and uncommon having been crafted from 10 unique types of casks.”

Approximately 2,000 bottles of Blue Note Special Reserve are now available for purchase online at BlueNoteBourbon.com and in 20 U.S. states (as listed below). The suggested retail price for a 750ml bottle is $225.

Blue Note’s whiskey portfolio is distilled in partnership with Bardstown Bourbon Company (parent company of Green River Distilling) and then aged just north of downtown Memphis where the Mississippi and Wolf Rivers collide. The long summers filled with infamous Memphis heat and cooler evenings forces the whiskey deep into the oak, creating an unmistakably rich flavor that’s bold yet smooth.

In addition to the aforementioned limited releases, award-winning flagship Blue Note portfolio includes Juke Joint ($34.99), Crossroads ($44.99), Uncut ($49.99), and Straight Rye Whiskey ($34.99). At the 2024 San Francisco World Spirits Competition, Juke Joint and Crossroads were awarded Platinum medals, a rare honor meaning that each expression has received Double Gold medals for three consecutive years.

Production Facility & Tasting Room

Blue Note’s 110,000 square foot production facilities, located on Royal Avenue just North of downtown Memphis, are open from Monday through Friday from 10am – 4:00pm CST and include a unique and intimate tasting room. Guided tours are available on Thursdays and Fridays for $10 plus tax & fees. Guests can add a Tasting Flight Experience for an additional $5. Please follow Blue Note on Facebook and Instagram.

About B.R. Distilling Company

Founded in 2014 in Memphis, TN, B.R. Distilling Company is the oldest licensed distillery in Memphis, TN, and producer of world-famous Blue Note Bourbon. Currently, the company produces four flagship expressions, along with regular limited releases, which are distributed across 20 U.S. states, including AL, AR, CO, CT, FL, GA, KS, KY, LA, MA, MI, MS, MO, NY, NJ, OK, RI, SC, TN, and TX, and online at BlueNoteBourbon.com via Bevstack, which can be shipped to: AZ, CA, CO, CT, DE, FL, GA, IA, ID, IL, IN, KS, KY, MD, MN, MO, NC, ND, NE, NH, NJ, NM, NV, NY, OH, OK, OR, PA, RI, TX, VA, WA and WI. Take note. Sip responsibly.

# # #

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

PepsiCo Reportedly Nears Settlement With $4B Investor

PepsiCo Reportedly Nears Settlement With $4B Investor

New Products: Beekeeper Gets Spicy, Protein Water Expands

New Products: Beekeeper Gets Spicy, Protein Water Expands

Monster, Coca-Cola Affirm Ties to Expand Category Reach, Drive Global Growth

Monster, Coca-Cola Affirm Ties to Expand Category Reach, Drive Global Growth

SPONSORED POST
Babe Kombucha’s Hawaiian POG Triumphs at the World Kombucha Awards 2025.

Babe Kombucha’s Hawaiian POG Triumphs at the World Kombucha Awards 2025.

Marketplace

Contract Production & CoPacking Partner to Grow Your Brand

Contract Production & CoPacking Partner to Grow...

View All|Post a Listing

Featured Jobs

State Manager - South Carolina - Good Boy Vodka

State Manager - South Carolina - Good Boy Vodka

On-Premise/Special Projects Manager - Daytona Beach, FL - Carbliss

On-Premise/Special Projects Manager - Daytona B...

Area Sales Manager - Columbus, OH - Good Boy Vodka

Area Sales Manager - Columbus, OH - Good Boy Vodka

Regulatory Compliance Manager - Tree House Brewing Company

Regulatory Compliance Manager - Tree House Brew...

Director Of Hospitality - Three Taverns Brewery

Director Of Hospitality - Three Taverns Brewery

Sales & Marketing Coordinator - Better Sour

Sales & Marketing Coordinator - Better Sour

View All Jobs|Post a Job

More News

Monster Backing Female-Focused Innovation, ‘Premium’ Partnerships

Monster Backing Female-Focused Innovation, ‘Premium’ Partnerships

Zero Proof Playbook: John Wiseman of Curious Elixirs On A Decade In Adult Non-Alc

Zero Proof Playbook: John Wiseman of Curious Elixirs On A Decade In Adult Non-Alc

BevNET Announces Nominees for 2025 Spirits Awards

BevNET Announces Nominees for 2025 Spirits Awards

San Francisco To Sue Ultraprocessed Food Makers

San Francisco To Sue Ultraprocessed Food Makers

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Delivery Driver - Birdsmouth Beer - Birdsmouth Beer
  • Headbrewer/Brewmaster - Free Roam Brewing Company - Free Roam Brewing Company
  • Director of Operations - Odara Functinal Beverage - Odara Functinal Beverage
  • Marketing & Community Manager - Three Trees - Three Trees
  • National Sales Director - Three Trees - Three Trees
  • Sr Manager of Brewery Experience & Hospitality - Sierra Nevada Brewing Co - Sierra Nevada Brewing Co
  • Manufacturing Maintenance Technician - Full Sail Brewing Company - Full Sail Brewing Company
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Taste Radio: Erewhon Delivers The Heat. Landmark Lawsuits & 7-Eleven Sandos.
  2. PepsiCo Reportedly Nears Settlement With $4B Investor
  3. New Products: Beekeeper Gets Spicy, Protein Water Expands
  4. Monster, Coca-Cola Affirm Ties to Expand Category Reach, Drive Global Growth
  5. Lake Hour Hires First CEO, Eyes Hard Tea Expansion
  6. Reviews: Pepsi Prebiotic Impresses, Mirth Water Brings Joy
  7. Monster Backing Female-Focused Innovation, ‘Premium’ Partnerships
  1. Perro Verde Named Event Partner for Art Basel's Inaugural Awards Night
  2. American Rebel Light Secures Third Pennsylvania Distributor as Mid-State Beverage Company Supercharges National Rollout
  3. Sensient Introduces The Pipeline for Beverage Creators
  4. Empress 1908 Gin Partners with Independent Collection Hotels & Resorts on Holiday Cocktail Experience
  5. Celt Salt Introduces HydroCelt Clean Hydration Electrolyte Drink Mix
  6. Holiday Vodka, Crafted in Italy, Celebrates Launch in New York City
  7. Introducing Pezuña Blanca: An Organic Tequila Rooted in Heritage
  1. Lake Hour Hires First CEO, Eyes Hard Tea Expansion
  2. Zero Proof Playbook: John Wiseman of Curious Elixirs On A Decade In Adult Non-Alc
  3. Scotland’s Spirits Of Virtue Builds Arkansas Facility To Scale NA Tequila, Bourbon
  4. Bev-Alc Sales Slide Ahead of The Holidays
  5. Spirit Brands Preach Pivot from CPG Marketing Playbook
  6. CGA: Feelings Fuel On-Premise Choices Except For RTDs
  7. A Drink With… Katie Cooper, Co-Founder of Cooper Spirits
  1. Monster and Coca-Cola Strengthen Partnership to Drive Global Growth
  2. Flavorman 2026 Beverage Predictions: Fruity & Indulgent Flavors, Caffeine Alternatives and Convenience
  3. Beer Institute: October Domestic Shipments Decline Following 1 Month Uptick
  4. Lake Hour’s New CEO Sets Sights On Hard Tea, Market Expansion
  5. The Lost Abbey’s Tomme Arthur on Turning Surviving Into Thriving and California’s Real Estate Squeeze
  6. From Value to Vibe at Brewbound Live 2025: NIQ & CGA on Balancing What’s Brewing Across Price, Preference & Purpose
  7. BeerBoard: On-Premise Volumes Drop Big on Thanksgiving Eve
View All|Submit News

Promoted PR Posts

Botanic Tonics' feel free CLASSIC Climbs Past Household Brands to #1 Spot at a Top Five National U.S. Convenience Retailer

Botanic Tonics' feel free CLASSIC Climbs Past Household Brands to #1 Spot at a Top Five National U.S. Convenience Retailer

6 Seeds Launches Synthetic Research Platform for the Food and Agriculture Sector

6 Seeds Launches Synthetic Research Platform for the Food and Agriculture Sector

GNGR Labs Debuts New Gut Health Booster Shot

GNGR Labs Debuts New Gut Health Booster Shot

Hummingbirds Releases Report on the State of the Everyday Creator Ahead of 2026

Hummingbirds Releases Report on the State of the Everyday Creator Ahead of 2026

NHL Superstar Nathan MacKinnon Joins Chilly Ones as Brand Ambassador

NHL Superstar Nathan MacKinnon Joins Chilly Ones as Brand Ambassador

You Share a Beer, We Share a Truck: Stone Brewing Partners with Flock Freight to Optimize Shipping with Shared Truckload

You Share a Beer, We Share a Truck: Stone Brewing Partners with Flock Freight to Optimize Shipping with Shared Truckload

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
© 1996 – 2025 BevNET.com® Terms of Use Privacy Policy
Back
03/11: Introducing...Nombase! 03/13: Expo West Roundup: Standout Products & Trends from Key Decision Makers 03/20: Growing at Retail: What Does Smart Growth Look Like? 03/27: Smart Demos, Steady Growth. A Cost-Effective Strategy for Retail.
View Community Call Calendar
An error has occurred. This application may no longer respond until reloaded. Reload 🗙