• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

B.R. Distilling Company Launches Limited-Release Blue Note Special Reserve

info_outline PRESS RELEASE posted by Blue Note Bourbon

Feb. 10, 2025 at 10:39 am

X LinkedIn Reddit Facebook Email
Report Press Release
bourbonbourbonwhiskeybluenotebourbonspecialreservecaskfinishedserieslimitedrelease
Spirits Companies
  • image-01

Blend of Straight Bourbon Whiskeys Finished in 10 Different Casks is the Latest Expression in the Company’s Cask Finished Series

Memphis, TN (February 10, 2025) – Blue Note Bourbon™, the award-winning whiskey portfolio which is artfully crafted to honor the rich blues music that is synonymous with Memphis, has launched its second-annual Special Reserve Straight Bourbon Whiskey.

Crafted in Memphis, the limited-release is a blend of 10 casks from Kentucky and Tennessee – cognac, madeira, sherry, port, triple sec, madeira, apricot brandy, amontillado, vanilla cognac and vino de Naranja – ranging in age from four to 19 years with varying mashbills. The new expression was bottled at 116.3 proof (58.15% ABV), unfiltered.

Special Reserve Tasting Notes

·       Nose: Bright fruit, cherry, peach, leather, oak and vanilla

·       Palate: Creamy and light, oak, vanilla, roasted nuts, dark chocolate, and citrus

·       Finish: Light warmth with a chewy, slightly dry texture that lingers

In addition to last year’s Special Reserve, Blue Note has introduced several other highly awarded limited-release offerings, which include Premium Small Batch, Single Barrel Reserve, 17-year, and most recently a Honey Rye and Honey Bourbon Cask.

“Having launched several wildly successful limited releases in recent years, whiskey enthusiasts have come to expect these types of unique offerings from Blue Note,” said Chris Crosbie, Vice President, Sales, B.R. Distilling Company. “This year’s Special Reserve is both exceptional and uncommon having been crafted from 10 unique types of casks.”

Approximately 2,000 bottles of Blue Note Special Reserve are now available for purchase online at BlueNoteBourbon.com and in 20 U.S. states (as listed below). The suggested retail price for a 750ml bottle is $225.

Blue Note’s whiskey portfolio is distilled in partnership with Bardstown Bourbon Company (parent company of Green River Distilling) and then aged just north of downtown Memphis where the Mississippi and Wolf Rivers collide. The long summers filled with infamous Memphis heat and cooler evenings forces the whiskey deep into the oak, creating an unmistakably rich flavor that’s bold yet smooth.

In addition to the aforementioned limited releases, award-winning flagship Blue Note portfolio includes Juke Joint ($34.99), Crossroads ($44.99), Uncut ($49.99), and Straight Rye Whiskey ($34.99). At the 2024 San Francisco World Spirits Competition, Juke Joint and Crossroads were awarded Platinum medals, a rare honor meaning that each expression has received Double Gold medals for three consecutive years.

Production Facility & Tasting Room

Blue Note’s 110,000 square foot production facilities, located on Royal Avenue just North of downtown Memphis, are open from Monday through Friday from 10am – 4:00pm CST and include a unique and intimate tasting room. Guided tours are available on Thursdays and Fridays for $10 plus tax & fees. Guests can add a Tasting Flight Experience for an additional $5. Please follow Blue Note on Facebook and Instagram.

About B.R. Distilling Company

Founded in 2014 in Memphis, TN, B.R. Distilling Company is the oldest licensed distillery in Memphis, TN, and producer of world-famous Blue Note Bourbon. Currently, the company produces four flagship expressions, along with regular limited releases, which are distributed across 20 U.S. states, including AL, AR, CO, CT, FL, GA, KS, KY, LA, MA, MI, MS, MO, NY, NJ, OK, RI, SC, TN, and TX, and online at BlueNoteBourbon.com via Bevstack, which can be shipped to: AZ, CA, CO, CT, DE, FL, GA, IA, ID, IL, IN, KS, KY, MD, MN, MO, NC, ND, NE, NH, NJ, NM, NV, NY, OH, OK, OR, PA, RI, TX, VA, WA and WI. Take note. Sip responsibly.

# # #

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Taste Radio: Why The Next Big Thing—In Booze Or Beyond—Is Often Borrowed

Taste Radio: Why The Next Big Thing—In Booze Or Beyond—Is Often Borrowed

Hemp Beverages Grew 133% Last Year, HBA Reports

Hemp Beverages Grew 133% Last Year, HBA Reports

People Moves: ROAR Organic, Refresco Welcome New Presidents

People Moves: ROAR Organic, Refresco Welcome New Presidents

SPONSORED POST
Connecting Benefits with Flavor to Build Trust in Functional Beverages

Connecting Benefits with Flavor to Build Trust in Functional Beverages

Marketplace

Award Winning Beverage Formulation

Award Winning Beverage Formulation

View All|Post a Listing

Featured Jobs

State Manager - Georgia - Spiked Ade

State Manager - Georgia - Spiked Ade

Brewery positions - Mountains Walking Brewery/New Hokkaido Bevco

Brewery positions - Mountains Walking Brewery/N...

Los Angeles Field Sales Representative - Allagash Brewing Company

Los Angeles Field Sales Representative - Allaga...

Sales Director - Confidential Growth-Phase CPG Beverage Company

Sales Director - Confidential Growth-Phase CPG ...

Sales Support Intern - MOTH Drinks Ltd

Sales Support Intern - MOTH Drinks Ltd

Area Sales Manager - MD/DC - Good Boy Vodka

Area Sales Manager - MD/DC - Good Boy Vodka

View All Jobs|Post a Job

More News

New Beverages: GT’s Brings Kombucha to Cans, Silk Pumps Up the Protein

New Beverages: GT’s Brings Kombucha to Cans, Silk Pumps Up the Protein

Zero Proof Playbook: Jill Sites On How To Find Growth In Adult Non-Alc

Zero Proof Playbook: Jill Sites On How To Find Growth In Adult Non-Alc

Albertsons Is Now Testing Hemp THC Drinks In Chicago

Albertsons Is Now Testing Hemp THC Drinks In Chicago

Distribution: Big Geyser Adds Gym Weed, Gym Soda to Roster

Distribution: Big Geyser Adds Gym Weed, Gym Soda to Roster

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Taproom General Manager - Three Taverns Craft Brewery - Three Taverns Craft Brewery
  • Brewer - The Cayman Islands Brewery - The Cayman Islands Brewery
  • Brewer - WeldWerks Brewing Co - WeldWerks Brewing Co
  • Area Sales Manager - Paulaner USA - Paulaner USA
  • Brand Director - Firestone Walker Brewing Co - Firestone Walker Brewing Co
  • Graphic Artist - Good Boy Vodka - Good Boy Vodka
  • National Sales Director – Beverage Manufacturing & Product Development - MetaBrand LLC - MetaBrand LLC
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Taste Radio: Why The Next Big Thing—In Booze Or Beyond—Is Often Borrowed
  2. Hemp Beverages Grew 133% Last Year, HBA Reports
  3. People Moves: ROAR Organic, Refresco Welcome New Presidents
  4. New Beverages: GT’s Brings Kombucha to Cans, Silk Pumps Up the Protein
  5. Zero Proof Playbook: Jill Sites On How To Find Growth In Adult Non-Alc
  6. Albertsons Is Now Testing Hemp THC Drinks In Chicago
  7. Distribution: Big Geyser Adds Gym Weed, Gym Soda to Roster
  1. Bubl Cocktail Shots Introduces the Future of Molecular Mixology Nationwide
  2. Plexus Worldwide Launches Superfoods, a Greens Powder for Gut Health and Immune Health
  3. AdvoCare Rehydrate Black Cherry Drops for a Limited Time, Offering Bold Flavor and Rapid Hydration
  4. Celebrating 100 Years: Root Shoot Malting’s Olander Farms Earns Colorado Centennial Farm Designation!
  5. f'real By Rich's Debuts New Blender and Summer Flavors: Orange Creamsicle Milkshake and Frozen Lemonade
  6. Colorado’s Branch & Barrel Distilling’s 2026 Marked by Growth, Giving & Awards
  7. The First Chapter of Pelacañas SOLERA Begins with Edition Zero
  1. Zero Proof Playbook: Jill Sites On How To Find Growth In Adult Non-Alc
  2. Joel Gott Wines, Powerhouse Producer of Affordable Wines, Turns To RTDs
  3. In Rebrand, Free Spirits Ditches The Wellness Pitch For Cocktail Culture
  4. Brown-Forman CEO Lawson Whiting to Retire as Successor Search Begins
  5. As Uncle Nearest Sale Nears, Receiver Alleges Lender Ignored ‘Red Flags’
  6. Spirits Distribution: RNDC Fallout Squeezes Suppliers; SGWS Cuts Jobs; Suppliers Jump to Reyes
  7. Southern Glazer’s to Cut 1% of Workforce in Digital Sales Shift
  1. Insider’s Week in Beer: 💍 Marriage Getting Twisted? Get Tea
  2. 21st Amendment, TTB Agree to $423k+ Offer in Compromise
  3. Vine Street’s Annie McGinnis to Lead National Black Brewers Association as President
  4. Press Clips: James Watt’s Offer for BrewDog; Atwater Grand Rapids to Close; Lost Abbey’s Monastery Officially Opens
  5. Hemp Beverage Volume +133% in 2025, per Hemp Beverage Alliance
  6. Baller Moves: Girl Beer Targets Rapid Expansion, Fueled by Dallas Wings Deal, Chain Placements and Variety Packs
  7. World Cup Draft Boost Sustained Thru Later Tournament Stages, per BeerBoard
View All|Submit News

Promoted PR Posts

Waiakea Hawaiian Volcanic Beverages Marks 14 Years of Sustainable Innovation with the Launch of Pa'a Premium Glass Collection

Waiakea Hawaiian Volcanic Beverages Marks 14 Years of Sustainable Innovation with the Launch of Pa'a Premium Glass Collection

Paramount Coffee Debuts Joe Knows Coffee Cold Brew: It's Not Your Average (Cup of) Joe

Paramount Coffee Debuts Joe Knows Coffee Cold Brew: It's Not Your Average (Cup of) Joe

Pete Grego Beverage Business Consulting, LLC

Pete Grego Beverage Business Consulting, LLC

Branding for Buyout: A New Playbook for the Food Industry

Branding for Buyout: A New Playbook for the Food Industry

Säti Ginger CBD Soda Named 2026 Good Food Award Winner

Säti Ginger CBD Soda Named 2026 Good Food Award Winner

Perico Energy Announces It Is Ready to Bring High-Octane Vitality to the World Stage

Perico Energy Announces It Is Ready to Bring High-Octane Vitality to the World Stage

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙