• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Fettercairn Whisky Opens a New Chapter in the U.S., Inviting Discovery Through Its Core Range of Tropical Single Malts

info_outline PRESS RELEASE posted by Cork + Knife Communications

Apr. 14, 2026 at 1:29 pm

X LinkedIn Reddit Facebook Email
Report Press Release
scotchsingle maltwhiskeywhiskyfettercairntropicalluxuryspiritpremium
Spirits CompaniesFood Companies
  • image-01

Featuring the 12- and 16-Year-Old expressions, offering curious whisky lovers and connoisseurs a new dimension of flavor through Fettercairn’s signature house style

NEW YORK, NY | Fettercairn Single Malt Scotch Whisky is one of the whisky world’s most coveted hidden gems – a Highland distillery prized for its rare, aged, and highly allocated single malts across more than two centuries of craft. Today, the internationally award-winning Highland distillery, renowned for its tropical house style and innovative distillation process, marks its most significant U.S. expansion yet with the introduction of its 12-Year-Old and 16-Year-Old Single Malts, offering a refined yet welcoming entry point into its celebrated world of flavor.

“As Fettercairn continues to grow in the U.S., these two releases mark an important step in inviting more whisky drinkers to experience our house style,” said Andrew Kullhem, President of North America for Whyte & Mackay. “They offer a clear expression of our tropical character—bringing together innovation, maturation, and craftsmanship in a way that invites discovery, whether you’re exploring single malt for the first time or deepening an existing appreciation.”

Rooted in more than 200 years of whisky-making expertise, Fettercairn takes a progressive, flavor-led approach that begins with its distinctive new make spirit. Defined by notes of tropical fruit, nutty cereal, and a signature silky mouthfeel with subtle coconut richness, this foundational character is refined by its unique copper cooling ring distillation process. By cascading cool water from the nearby Cairngorm Mountains over the stills, the copper is rapidly cooled, allowing only the lightest vapors to rise and bringing greater precision to how flavor is developed.

The result is a whisky that is vibrant, expressive, and unmistakably Fettercairn—something Distillery Manager Stewart Walker, who has spent over three decades shaping the character of Fettercairn, describes as a balance between purity and craft. “That process gives us a beautifully light, tropical spirit to work with, and from there, it’s about shaping that character with care—preserving its freshness while building texture and complexity through maturation. It’s an imaginative approach to Highland Single Malt Scotch.”

Fettercairn 12-Year-Old | SRP $54.99; 46% ABV; natural color and non-chill filtered

An inviting introduction to the distillery’s signature style, this expression is matured in ex-bourbon American white oak barrels for at least 12 years. The nose opens with vanilla and pear, softened by gentle spice, leading to a palate of nectarine and tropical fruit deepened by notes of roasted coffee, clove, and ginger. The finish lingers on golden raisins and black toffee.

Fettercairn 16-Year-Old | SRP $89.99; 46.4% ABV; natural color and non-chill filtered

Offering greater depth and complexity, this expression is aged for at least 16 years in a combination of first-fill and refill American oak ex-bourbon barrels and hogsheads. Aromas of grilled pineapple, Madagascan vanilla, and sugared almonds give way to a rich palate of tropical fruit, poached pear, and honey. Notes of vanilla, almond, and warming spice carry through to the finish.

“What’s exciting about these two expressions is how they allow the spirit to show itself in different ways,” added Walker. “It’s about revealing new dimensions of that tropical profile over time.”

Both expressions have been recognized by leading authorities, with the 12-Year-Old awarded 93 points by Wine Enthusiast and 92 points by Whisky Advocate, while the 16-Year-Old received 95 points and 93 points, respectively.

The Fettercairn 12-Year and 16-Year-Old Single Malts will be available nationwide through key retailers and leading on-premise destinations.

--

Press Contact: Ashley Lipyansky - Cork + Knife Communications

About Fettercairn

Fettercairn Distillery is a hidden gem – an award-winning Single Malt Scotch Whisky Distillery located in the heart of a thriving agricultural community, Aberdeenshire - ‘The Garden of Scotland’. A spark of whisky-making ingenuity is what makes Fettercairn special. A sense of wonder has been a constant theme back to 1824, as illustrated by our beautiful copper cooling ring, which produces a uniquely tropical style of new make spirit. With over 200 years of expertise, we continue to take a progressive outlook and make new unexpected journeys in flavor-led whisky-making. We invite curious whisky lovers and connoisseurs to explore and enjoy Fettercairn Single Malt.

Award-Winning Whisky Makers Whyte and Mackay

Whyte and Mackay is home to a collection of multi-award-winning Single Malt Whiskies including The Dalmore, Jura and Fettercairn. With a premium spirits portfolio that includes contemporary whisky brands Shackleton, Woodsman and John Barr, alongside popular alcohol brands Wildcat, Fundador, Harveys Bristol Cream and Aperitivo. In the UK, the company produces Whyte & Mackay, an award-winning ever-popular Blended Whisky, which recently launched the market-leading ‘Whyte & Mackay Light’ – a lighter spirit drink from Scotland, bottled at a lower ABV. Founded in Glasgow 1844, the whisky makers celebrated their 175-year anniversary in 2019. Today, Whyte and Mackay have offices from New York to Singapore. In Scotland, Whyte and Mackay operate a state-of-the-art Bottling Hall and Distribution Centre in Grangemouth and a Whisky Production and Warehousing Centre in Invergordon.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

Wellness Shoppers Seeking Proof Over Promises, Says Vitamin Shoppe Report

Wellness Shoppers Seeking Proof Over Promises, Says Vitamin Shoppe Report

Supreme Court Agrees to Hear Rise Brewing Trademark Case Against PepsiCo

Supreme Court Agrees to Hear Rise Brewing Trademark Case Against PepsiCo

Yesly Refreshes Packaging, Prepares Clear Protein Launch

Yesly Refreshes Packaging, Prepares Clear Protein Launch

SPONSORED POST
Connecting Benefits with Flavor to Build Trust in Functional Beverages

Connecting Benefits with Flavor to Build Trust in Functional Beverages

Marketplace

Private Label Drinks in Cans & Bottles - Beverage Specialists - mbabeverage.com

Private Label Drinks in Cans & Bottles - Bevera...

View All|Post a Listing

Featured Jobs

Pubs General Manager - Fort George Brewery

Pubs General Manager - Fort George Brewery

Packaging Lead - pFriem Family Brewers

Packaging Lead - pFriem Family Brewers

Facilities Technician - Wilding Brands

Facilities Technician - Wilding Brands

Accounting Manager - Marble Brewery

Accounting Manager - Marble Brewery

District Manager - Los Angeles & Central Coast - Coronado Brewing

District Manager - Los Angeles & Central Coast ...

Area Sales Manager - Inland Empire, CA - Good Boy Vodka

Area Sales Manager - Inland Empire, CA - Good B...

View All Jobs|Post a Job

More News

Non-Alc Beverage Sales Stay Stable in Early June

Non-Alc Beverage Sales Stay Stable in Early June

Coca-Cola Elevates CFO To Interim North America Leader As Jennifer Mann Steps Down

Coca-Cola Elevates CFO To Interim North America Leader As Jennifer Mann Steps Down

New Products: Rockstar Mocktails, Hot Girl Pickle Lemonade and More NA Creations

New Products: Rockstar Mocktails, Hot Girl Pickle Lemonade and More NA Creations

LivReal Gets Realistic with Clean Energy Drink Launch

LivReal Gets Realistic with Clean Energy Drink Launch

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Regional Marketing Coordinator - Good Boy Vodka - Good Boy Vodka
  • Utah State Sales Representative - Ska Brewing - Ska Brewing
  • Chief Operating Officer - Pure Madness Group (Melvin & Roadhouse Breweries) - Pure Madness Group (Melvin & Roadhouse Breweries)
  • Field Sales Manager - Lagunitas Brewing Company - Lagunitas Brewing Company
  • Brand Representative - Baton Rouge/Lake Charles Area, LA - Good Boy Vodka - Good Boy Vodka
  • Sales Representative - Finback Brewery - Finback Brewery
  • Manufacturing Supervisor - Berkeley Yeast - Berkeley Yeast
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Wellness Shoppers Seeking Proof Over Promises, Says Vitamin Shoppe Report
  2. Supreme Court Agrees to Hear Rise Brewing Trademark Case Against PepsiCo
  3. Yesly Refreshes Packaging, Prepares Clear Protein Launch
  4. Non-Alc Beverage Sales Stay Stable in Early June
  5. Coca-Cola Elevates CFO To Interim North America Leader As Jennifer Mann Steps Down
  6. New Products: Rockstar Mocktails, Hot Girl Pickle Lemonade and More NA Creations
  7. LivReal Gets Realistic with Clean Energy Drink Launch
  1. A Rare American-Made Mineral Water: Cedar Mountain Meets the Federal Standard in a Category Built on Imports
  2. Verde. is the top-performing non-alcoholic brand at the 2026 San Francisco Ready-to-Drink Competition
  3. Awesome Aminos Launches Awesome Everyday™ — the Only Daily Gummy With 9 Essential Amino Acids and a Superfood Blend
  4. Rupee Beer Brings Back Award-Winning Mango Wheat Ale for Summer
  5. Botanic Tonics Announces KavaMaté Nationwide Retail Availability Following Successful First Year in Market
  6. Sagamore Whiskey Announces National Release of High Rye Straight Bourbon Whiskey
  7. Lux & Luna Launches a Coffee-Free Latte That Tastes Like Coffee
  1. Adam Kost on How Dirty Shirley Cleaned Up
  2. Reports: Diageo Layoffs Hit North American Business Unit
  3. Owl’s Brew Follows Hard Soda Debut With Functional NA Mixers
  4. NÜTRL Founders Back Los Sundays Expansion
  5. The Zero Proof Acquires The New Bar For On-Premise Reach
  6. Brown-Forman, Sazerac Bet on New RTDs as Category Buoys Spirits Growth
  7. Tentative Settlement Reached in FTC’s Price Discrimination Lawsuit Against Southern Glazer’s
  1. How Dirty Shirley Cleaned Up with Sazerac Deal
  2. Craft Negative Trends Stabilize in June; Grocery Continues to Offset C-Store Gains, Per Circana Monthly Report
  3. Keg 1 Missouri to Acquire 1M+ Cases from Fechtel Beverage & Sales
  4. Insider’s Week in Beer: 🤞 Tilray Bets £1M (of Free Beer) On the World Cup
  5. Press Clips: NIQ’s Top 5 Beer Growth Manufacturers in the L4W; RNDC Illinois Layoffs Affect 280 Workers; Maui Light NA Returns
  6. World Cup Host Markets Score Big On-Premise; Beer Sales +5.5% in Bars & Restaurants Nationwide, Per Beer Institute
  7. Owl’s Brew Adds Functional Non-Alc Mixers
View All|Submit News

Promoted PR Posts

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

Paramount Coffee Debuts Joe Knows Coffee Cold Brew: It's Not Your Average (Cup of) Joe

Paramount Coffee Debuts Joe Knows Coffee Cold Brew: It's Not Your Average (Cup of) Joe

Flor de Caña - Official Rum of the Mutua Madrid Open 2026

Flor de Caña - Official Rum of the Mutua Madrid Open 2026

PLAYR Launches Performance Nutrition Brand Built Specifically for Youth Athletes

PLAYR Launches Performance Nutrition Brand Built Specifically for Youth Athletes

EL JEFE GLOBAL, LLC Announces Major Canadian Expansion with Beverage World Inc.

EL JEFE GLOBAL, LLC Announces Major Canadian Expansion with Beverage World Inc.

Dirty Dill Pickle Vodka Is Scaling Fast — and Inviting Its Community Along for the Ride

Dirty Dill Pickle Vodka Is Scaling Fast — and Inviting Its Community Along for the Ride

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙