• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Fettercairn Whisky Opens a New Chapter in the U.S., Inviting Discovery Through Its Core Range of Tropical Single Malts

info_outline PRESS RELEASE posted by Cork + Knife Communications

Apr. 14, 2026 at 1:29 pm

X LinkedIn Reddit Facebook Email
Report Press Release
scotchsingle maltwhiskeywhiskyfettercairntropicalluxuryspiritpremium
Spirits CompaniesFood Companies
  • image-01

Featuring the 12- and 16-Year-Old expressions, offering curious whisky lovers and connoisseurs a new dimension of flavor through Fettercairn’s signature house style

NEW YORK, NY | Fettercairn Single Malt Scotch Whisky is one of the whisky world’s most coveted hidden gems – a Highland distillery prized for its rare, aged, and highly allocated single malts across more than two centuries of craft. Today, the internationally award-winning Highland distillery, renowned for its tropical house style and innovative distillation process, marks its most significant U.S. expansion yet with the introduction of its 12-Year-Old and 16-Year-Old Single Malts, offering a refined yet welcoming entry point into its celebrated world of flavor.

“As Fettercairn continues to grow in the U.S., these two releases mark an important step in inviting more whisky drinkers to experience our house style,” said Andrew Kullhem, President of North America for Whyte & Mackay. “They offer a clear expression of our tropical character—bringing together innovation, maturation, and craftsmanship in a way that invites discovery, whether you’re exploring single malt for the first time or deepening an existing appreciation.”

Rooted in more than 200 years of whisky-making expertise, Fettercairn takes a progressive, flavor-led approach that begins with its distinctive new make spirit. Defined by notes of tropical fruit, nutty cereal, and a signature silky mouthfeel with subtle coconut richness, this foundational character is refined by its unique copper cooling ring distillation process. By cascading cool water from the nearby Cairngorm Mountains over the stills, the copper is rapidly cooled, allowing only the lightest vapors to rise and bringing greater precision to how flavor is developed.

The result is a whisky that is vibrant, expressive, and unmistakably Fettercairn—something Distillery Manager Stewart Walker, who has spent over three decades shaping the character of Fettercairn, describes as a balance between purity and craft. “That process gives us a beautifully light, tropical spirit to work with, and from there, it’s about shaping that character with care—preserving its freshness while building texture and complexity through maturation. It’s an imaginative approach to Highland Single Malt Scotch.”

Fettercairn 12-Year-Old | SRP $54.99; 46% ABV; natural color and non-chill filtered

An inviting introduction to the distillery’s signature style, this expression is matured in ex-bourbon American white oak barrels for at least 12 years. The nose opens with vanilla and pear, softened by gentle spice, leading to a palate of nectarine and tropical fruit deepened by notes of roasted coffee, clove, and ginger. The finish lingers on golden raisins and black toffee.

Fettercairn 16-Year-Old | SRP $89.99; 46.4% ABV; natural color and non-chill filtered

Offering greater depth and complexity, this expression is aged for at least 16 years in a combination of first-fill and refill American oak ex-bourbon barrels and hogsheads. Aromas of grilled pineapple, Madagascan vanilla, and sugared almonds give way to a rich palate of tropical fruit, poached pear, and honey. Notes of vanilla, almond, and warming spice carry through to the finish.

“What’s exciting about these two expressions is how they allow the spirit to show itself in different ways,” added Walker. “It’s about revealing new dimensions of that tropical profile over time.”

Both expressions have been recognized by leading authorities, with the 12-Year-Old awarded 93 points by Wine Enthusiast and 92 points by Whisky Advocate, while the 16-Year-Old received 95 points and 93 points, respectively.

The Fettercairn 12-Year and 16-Year-Old Single Malts will be available nationwide through key retailers and leading on-premise destinations.

--

Press Contact: Ashley Lipyansky - Cork + Knife Communications

About Fettercairn

Fettercairn Distillery is a hidden gem – an award-winning Single Malt Scotch Whisky Distillery located in the heart of a thriving agricultural community, Aberdeenshire - ‘The Garden of Scotland’. A spark of whisky-making ingenuity is what makes Fettercairn special. A sense of wonder has been a constant theme back to 1824, as illustrated by our beautiful copper cooling ring, which produces a uniquely tropical style of new make spirit. With over 200 years of expertise, we continue to take a progressive outlook and make new unexpected journeys in flavor-led whisky-making. We invite curious whisky lovers and connoisseurs to explore and enjoy Fettercairn Single Malt.

Award-Winning Whisky Makers Whyte and Mackay

Whyte and Mackay is home to a collection of multi-award-winning Single Malt Whiskies including The Dalmore, Jura and Fettercairn. With a premium spirits portfolio that includes contemporary whisky brands Shackleton, Woodsman and John Barr, alongside popular alcohol brands Wildcat, Fundador, Harveys Bristol Cream and Aperitivo. In the UK, the company produces Whyte & Mackay, an award-winning ever-popular Blended Whisky, which recently launched the market-leading ‘Whyte & Mackay Light’ – a lighter spirit drink from Scotland, bottled at a lower ABV. Founded in Glasgow 1844, the whisky makers celebrated their 175-year anniversary in 2019. Today, Whyte and Mackay have offices from New York to Singapore. In Scotland, Whyte and Mackay operate a state-of-the-art Bottling Hall and Distribution Centre in Grangemouth and a Whisky Production and Warehousing Centre in Invergordon.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Taste Radio: Building An Under The Radar Superstar. How Toom Is Taking Over.

Taste Radio: Building An Under The Radar Superstar. How Toom Is Taking Over.

How Can Brands Turn Gameplay into Growth?

How Can Brands Turn Gameplay into Growth?

People Moves: 100 Coconuts, Casa Azul Update Leadership Team

People Moves: 100 Coconuts, Casa Azul Update Leadership Team

SPONSORED POST
Rethinking Functional Beverages: Mainstream Price, Mainstream Velocity

Rethinking Functional Beverages: Mainstream Price, Mainstream Velocity

Marketplace

Bulk Tequila - Private Label Tequila

Bulk Tequila - Private Label Tequila

View All|Post a Listing

Featured Jobs

Senior Supply Chain Manager - Full Sail Brewing Company

Senior Supply Chain Manager - Full Sail Brewing...

State Manager - VA/WV - Good Boy Vodka

State Manager - VA/WV - Good Boy Vodka

Area Sales Manager - MA/RI - Good Boy Vodka

Area Sales Manager - MA/RI - Good Boy Vodka

Production Brewer - No-Li Brewhouse

Production Brewer - No-Li Brewhouse

Bay Area Delivery Driver - Bottle Logic Brewing

Bay Area Delivery Driver - Bottle Logic Brewing

Sales Manager - Ola Brew

Sales Manager - Ola Brew

View All Jobs|Post a Job

More News

No Sleep Beverage Makes Three Acquisitions With Plans To Further Expand Portfolio

No Sleep Beverage Makes Three Acquisitions With Plans To Further Expand Portfolio

Pablo’s Mate Signs with LAD, Preps Soccer-Themed Summer Campaign

Pablo’s Mate Signs with LAD, Preps Soccer-Themed Summer Campaign

Mark Anthony Brands to Acquire Finnish Long Drink

Mark Anthony Brands to Acquire Finnish Long Drink

Suja Life Files for IPO

Suja Life Files for IPO

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Chain Account Manager - Central Denver - Elite Brands of Colorado - Elite Brands of Colorado
  • Cellar Technician - Wilding Brands - Wilding Brands
  • Senior Brand Development Manager – California | El Tequileño Tequila - Paradise Spirits - Paradise Spirits
  • Market Manager - Las Vegas - Lagunitas Brewing Company - Lagunitas Brewing Company
  • Asheville General Manager - Hi-Wire Brewing - Hi-Wire Brewing
  • Brewery Process Engineer - Sierra Nevada Brewing Co. - Sierra Nevada Brewing Co.
  • Brewer - TALEA Beer Co - TALEA Beer Co
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Taste Radio: Building An Under The Radar Superstar. How Toom Is Taking Over.
  2. How Can Brands Turn Gameplay into Growth?
  3. People Moves: 100 Coconuts, Casa Azul Update Leadership Team
  4. No Sleep Beverage Makes Three Acquisitions With Plans To Further Expand Portfolio
  5. Pablo’s Mate Signs with LAD, Preps Soccer-Themed Summer Campaign
  6. Mark Anthony Brands to Acquire Finnish Long Drink
  7. Suja Life Files for IPO
  1. Lapo’s Gains Momentum Launching Nationwide at Target and Whole Foods Market as the No-Alcohol Category Accelerates
  2. Teko Redefines the Energy Ritual with the Launch of Premium Instant Yerba Mate Sticks
  3. BCB Brooklyn 2026 Expands Its Education Program With New Stages, Deeper Skill-Building and Industry-Leading Voices
  4. Autumn Nethery Named Vice President of Operations of PaPaw's Ridge
  5. Pour Yourself a Glass of New Zealand This May
  6. Fettercairn Whisky Opens a New Chapter in the U.S., Inviting Discovery Through Its Core Range of Tropical Single Malts
  7. Mitra9 Lights the Fuse with Crimson Spark, a New Functional Shot Drop
  1. No Sleep Beverage Makes Three Acquisitions With Plans To Further Expand Portfolio
  2. Mark Anthony Brands to Acquire Finnish Long Drink
  3. Sazerac Enters the Ring for Brown-Forman, But Analysts Are Skeptical
  4. SEC Sues Drake’s Organic Spirits For $2.4M In Investor Fraud
  5. Report: Sazerac Explores Brown-Forman Deal Following Pernod Ricard Merger Talks
  6. 514 Eagle Rock Colorado Employees Face Layoffs After Southern Glazer’s Sale, Per WARN Notice
  7. Old World, New Bet: Branca’s President On Taking a Stake in Alcohol-Removal Tech
  1. Brewers Association: Craft 2025 Production Volume -5.1%; 1,072 Brewery Closures in Last 2 Years
  2. Brooklyn Brewery Rebrands Non-Alcoholic Beer Line
  3. Circana Q1 Highlights: Domestic Super Premium Led Share Gains; Molson Coors Sheds Most Among Top Vendors
  4. Circana Weekly Scans: Beer Down YoY in Early Easter Reads
  5. Mark Anthony Brands to Acquire Finnish Long Drink
  6. ‘$1 Out of Every $8 Spent on Craft Beer’ Going to New Belgium Brands, per CEO
  7. Ardagh Wins $175.5M Verdict in Boston Beer Can Volume Dispute; Boston to Appeal
View All|Submit News

Promoted PR Posts

VYV Hydration Selected as Emerging Brand for 2026 Nourishing Change Conference

VYV Hydration Selected as Emerging Brand for 2026 Nourishing Change Conference

Taste of Rum 2026 Exceeds Expectations: Nearly 1,800 Attendees and More Than 150 Rum Expressions

Taste of Rum 2026 Exceeds Expectations: Nearly 1,800 Attendees and More Than 150 Rum Expressions

Protein the Organic Way: Introducing Organic Valley® Protein Plus™ Ultra-Filtered Milk

Protein the Organic Way: Introducing Organic Valley® Protein Plus™ Ultra-Filtered Milk

Blue Bear Launches “Refresh” Functional Tea for Immunity & Hydration Support, Expands Into Full-Day Wellness Lineup

Blue Bear Launches “Refresh” Functional Tea for Immunity & Hydration Support, Expands Into Full-Day Wellness Lineup

POCA Launches a New Era of Sweetness, Without the Crash

POCA Launches a New Era of Sweetness, Without the Crash

Most Brands Get U.S. Expansion Wrong—Cascadia Managing Brands Releases New Guide to Fix It

Most Brands Get U.S. Expansion Wrong—Cascadia Managing Brands Releases New Guide to Fix It

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙