Login Become an Insider

Features

  • BevNET Live
  • Best of 2024 Awards
  • Spirits Awards
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • Content Calendar
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Best of 2025 Awards
      Submit Your Nominations
    • Spirit Awards 2025
      Submit Your Nominations
    • Community Call Topics
      Submit Questions & Topics for Future Calls
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Community Call
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2023 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
    • Supplier Finder
      Database of Suppliers & Service Providers
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Community Call
      Pressing Topics Impacting Businesses
    • Elevator Talk
      Watch Emerging Brands Pitch
    • Category Close-Up
      Dive into Major Food & Beverage Categories
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
Our Family of Brands
nosh brewbound taste-radionombase
  • BevNET Live
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Our Family of Brands
nosh brewbound taste-radionombase
  • Login
  • Account image
    User Icon
  • Subscription:
    Manage Account Sign Out
  • close Subscribe
    Sign In
Become an Insider
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

World Whiskey Society Launches 20-Year-Old Family Reserve Whiskey

info_outline PRESS RELEASE posted by World Whiskey Society

Dec. 20, 2024 at 10:39 am

X LinkedIn Reddit Facebook Email
Report Press Release
worldwhiskeysocietywhiskeyfamilyreservenewrelease
Spirits Companies
  • image-01

New York, NY - December 20, 2024 - World Whiskey Society (WWS), known for scouring the globe to create the world’s most interesting whiskeys, is proud to announce its latest release: a 20-year-old Family Reserve cask-proof whiskey. 

As AIKO Brands celebrates its 20th anniversary, they reflect on the extraordinary journey that has brought them here – a journey defined by craftsmanship, connection, and the enduring support of a loyal community of wine and spirits enthusiasts. Over two decades, AIKO Brands has grown into a symbol of passion and excellence, uniting people around the world with exceptional wine and spirits.

This year, they’re marking this milestone with something truly extraordinary: the release of the Family Reserve, a whiskey that encapsulates the very essence of their heritage. Aged for 20 years, it is a rare and remarkable spirit crafted to honor the past, celebrate the present, and inspire the future.

“This special Family Reserve release is a tribute to our father, Igor Kogan, inspired by his vision to create something timeless and beautiful – something that brings people together to celebrate life’s most precious moments. This release is more than just whiskey; it’s a story of transformation, growth, and the relentless pursuit of excellence” says Alex and Irina Kogan, Founders of World Whiskey Society. "As we raise our glasses to two decades of AIKO Brands, we invite you to celebrate with us — honoring the past, savoring the present, and toasting to the future.” adds Feliks Shekhtman, Aiko Brands Managing Partner. “Here's to the next 20 years of shared stories, laughter, and extraordinary whisky." 

The Family Reserve is not just a whiskey; it’s a heartfelt tribute to Igor Kogan, the visionary behind AIKO Brands. Born in Kiev, Ukraine, Igor was a man of remarkable talent and unyielding determination. A colonel in the Army, an educator, inventor, poet, musician, PhD, and later a college professor and entrepreneur in the United States, Igor’s life was defined by creativity, intellect, and resilience.

Igor’s dedication to building a strong family legacy and his belief that success can only be achieved through hard work formed the foundation upon which AIKO Brands was established and instilled that passion and values that are being carried on today through his daughter, Irina Kogan, son, Alex Kogan, and son-in-law, Feliks Shekhtman

The Family Reserve is a testament to the art of craftsmanship and mastery. Distilled at a renowned Kentucky distillery, the Family Reserve Cask Proof has been aged for 20 years with a Mash Bill of 74% Corn, 18% Rye, and 8% Malted Barley. A well-aged, luxurious dram with a harmonious balance of fruit, oak, and spice, all elevated by the nuances of roasted peanuts and butterscotch yielding exceptional depth and refinement.

This limited edition release is now available on WWS online shop and at select retailers nationwide for $1,500. For more information about WWS and its exceptional range of rare whiskeys, including this latest release, please visit the World Whiskey Society website.  

To honor Igor’s memory and his unwavering dedication to creating beauty in all things, 100% of the proceeds from the Family Reserve release will be donated to the Lustgarten Foundation. This organization is at the forefront of research and studies on pancreatic cancer, offering hope and advancing treatment for those impacted by this devastating disease.

About World Whiskey Society:

Established in 2020, the World Whiskey Society (WWS) comprises an ultra-premium collection of rare expressions previously unavailable to even the most sophisticated whiskey enthusiasts. WWS scours the globe far and wide with a singular goal in mind – uniqueness – before selecting a distillery partner to join WWS. Or they may choose to release something completely new by finishing small-batch American bourbon in exotic oak barrels from Japan. Whether it is the Classic Collection, the Reserve Collection, the tributes to Doc Holliday, or the Diamond Collection, WWS offers whiskies for everyday enjoyment and moments of celebration.

Media Contact: Sam O’Brien, Colangelo & Partners

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

Keychain Nets New $10M, Launches Retailer AI Tool

Keychain Nets New $10M, Launches Retailer AI Tool

Tariffs Force Hard Decisions For Liquor Retailers

Tariffs Force Hard Decisions For Liquor Retailers

Taste Radio: Hemp Bevs Take A Hit. Trip Keeps Calm & Raises $40M.

Taste Radio: Hemp Bevs Take A Hit. Trip Keeps Calm & Raises $40M.

SPONSORED POST
Sip Elixirs: Driving Growth in the Cannabis Beverage Market

Sip Elixirs: Driving Growth in the Cannabis Beverage Market

Marketplace

Co-Packing or Contract at Summit Brewing

Co-Packing or Contract at Summit Brewing

View All|Post a Listing

Featured Jobs

Director of Operations (Beverage) - Birdie / Wild State Cider

Director of Operations (Beverage) - Birdie / Wi...

Market Manager - San Diego County (SD Metro) - Owl's Brew

Market Manager - San Diego County (SD Metro) - ...

On-Premise/Special Projects Manager - Daytona Beach, FL - Carbliss

On-Premise/Special Projects Manager - Daytona B...

Remote Sales Rep - Breweries/Brands/Co-packers - Canworks (digitally printed cans)

Remote Sales Rep - Breweries/Brands/Co-packers ...

Southern California Craft Beverage Sales Rep & Chain Store Merchandiser's - ABC Distribution Southern California

Southern California Craft Beverage Sales Rep & ...

Area Sales Manager/Merchandiser Southern California - Cascadia Managing Brands

Area Sales Manager/Merchandiser Southern Califo...

View All Jobs|Post a Job

More News

Tariffs Force Hard Decisions For Liquor Retailers

Tariffs Force Hard Decisions For Liquor Retailers

Taste Radio: Hemp Bevs Take A Hit. Trip Keeps Calm & Raises $40M.

Taste Radio: Hemp Bevs Take A Hit. Trip Keeps Calm & Raises $40M.

Reviews: We Dive Into Dirty Mountain Dew, While Orange Toucan Flies

Reviews: We Dive Into Dirty Mountain Dew, While Orange Toucan Flies

Kratom Brand Mitra-9 Class Action Dismissed

Kratom Brand Mitra-9 Class Action Dismissed

Beverage Industry Jobs

  • Area Sales Manager - Indianapolis, IN - Good Boy Vodka - Good Boy Vodka
  • Baking School Manager, Vermont - King Arthur Baking Company - King Arthur Baking Company
  • Regional Sales Director - Mid-Atlantic (OH, KY, WV, VA, PA, MD, DE, DC) - Good Boy Vodka - Good Boy Vodka
  • Regulatory Compliance Manager - Tree House Brewing Company - Tree House Brewing Company
  • Production Manager - Uncle Matt's Organic - Uncle Matt's Organic
  • Accounting Director/Controller - SIMPLi - SIMPLi
  • Territory Sales Manager - Northern New England - Bevovations LLC, d/b/a New England Apple Products - Bevovations LLC, d/b/a New England Apple Products
View All|Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. BevNET Announces Nominees for ‘Best of 2025’ Awards
  2. BUM Energy Expands Sales Team Ahead of Walmart, Target Rollouts in 2026
  3. Keychain Nets New $10M, Launches Retailer AI Tool
  4. Tariffs Force Hard Decisions For Liquor Retailers
  5. Taste Radio: Hemp Bevs Take A Hit. Trip Keeps Calm & Raises $40M.
  6. Reviews: We Dive Into Dirty Mountain Dew, While Orange Toucan Flies
  7. Kratom Brand Mitra-9 Class Action Dismissed
  1. Inside La La Land's National Expansion - The Coffee Brand Built on Kindness
  2. GNGR Labs Debuts New Gut Health Booster Shot
  3. Maestro Dobel Tequila Introduces Tahona Tequila Blanco, Honoring Centuries of Tradition and Tequila-Making Craft
  4. Cincoro Tequila Unveils 'Cincoro Jack' Limited-Edition Añejo Bottle in Collaboration with Travis Scott
  5. Riunite Partners with Meals on Wheels America through Riunite & Give Campaign
  6. Jack Daniel's and Capitals Announce Fifth Single Barrel Personal Collection
  7. Bathtub Gin x Tart London Collaborate on Limited-Edition 'Folklore' Bottle Design
  1. Tariffs Force Hard Decisions For Liquor Retailers
  2. San Francisco Bar Star Thad Vogler Aims to Disrupt RTDs With New Brand
  3. Banking on Mexican-Inspired Flavors, Brown-Forman Expands New Mix in The US
  4. Diageo Names Consumer Industry Veteran as New CEO
  5. Spirits: New RTDs From Yoju, Big Sipz, Tip Top and More
  6. Alcohol Industry Trade Groups Back Ban on Intoxicating Hemp Beverages
  7. Cannabis Drinks Could Become Key Alcohol Replacement, Per Report
  1. Bev-Alc Retailers Grapple with Tariffs
  2. Insider’s Week in Beer: 🤓 Nerds Save Beer
  3. Report: Rogue Ales & Spirits to Cease Operations, Shutter Pubs
  4. Press Clips: Gen Z Craving ‘Product Customization;’ Creature Comforts LA Closes; Great Lakes Heads to Florida
  5. The Lonely Generation: Gen Z is Craving Connection & Beer Can be the Conduit
  6. Restaurateur to Acquire 10 Iron Hill Locations; Remaining 9 Set for Auction
  7. Thad Vogler Launches Waste Vodka Sodas Made From Upcycled Ingredients 
View All|Submit News

Promoted PR Posts

Vodka is Out, Magic is In: Cantrip Launches “Elixir,” a Hemp-Derived THC Spirit  Alternative Redefining the Cocktail Ritual

Vodka is Out, Magic is In: Cantrip Launches “Elixir,” a Hemp-Derived THC Spirit Alternative Redefining the Cocktail Ritual

The Odom Corporation Selects GoSpotCheck for Better Compliance, Merchandising and Retail Execution

The Odom Corporation Selects GoSpotCheck for Better Compliance, Merchandising and Retail Execution

The Only Kiwi Beer Available in America Arrives This Year

The Only Kiwi Beer Available in America Arrives This Year

Natural Immunogenics Corporation Becomes Sovereign Naturals

Natural Immunogenics Corporation Becomes Sovereign Naturals

Whale Pod Shipper Launches New "Tray Pods" — A Smarter, Safer, and Sustainable Way to Ship Canned Beverages

Whale Pod Shipper Launches New "Tray Pods" — A Smarter, Safer, and Sustainable Way to Ship Canned Beverages

Forall Nutrition Launches Water+Protein: The World's First Clear, Flavorless Protein Water

Forall Nutrition Launches Water+Protein: The World's First Clear, Flavorless Protein Water

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
© 1996 – 2025 BevNET.com® Terms of Use Privacy Policy
Back
03/11: Introducing...Nombase! 03/13: Expo West Roundup: Standout Products & Trends from Key Decision Makers 03/20: Growing at Retail: What Does Smart Growth Look Like? 03/27: Smart Demos, Steady Growth. A Cost-Effective Strategy for Retail.
View Community Call Calendar
An error has occurred. This application may no longer respond until reloaded. Reload 🗙