• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

World Whiskey Society Launches 20-Year-Old Family Reserve Whiskey

info_outline PRESS RELEASE posted by World Whiskey Society

Dec. 20, 2024 at 10:39 am

X LinkedIn Reddit Facebook Email
Report Press Release
worldwhiskeysocietywhiskeyfamilyreservenewrelease
Spirits Companies
  • image-01

New York, NY - December 20, 2024 - World Whiskey Society (WWS), known for scouring the globe to create the world’s most interesting whiskeys, is proud to announce its latest release: a 20-year-old Family Reserve cask-proof whiskey. 

As AIKO Brands celebrates its 20th anniversary, they reflect on the extraordinary journey that has brought them here – a journey defined by craftsmanship, connection, and the enduring support of a loyal community of wine and spirits enthusiasts. Over two decades, AIKO Brands has grown into a symbol of passion and excellence, uniting people around the world with exceptional wine and spirits.

This year, they’re marking this milestone with something truly extraordinary: the release of the Family Reserve, a whiskey that encapsulates the very essence of their heritage. Aged for 20 years, it is a rare and remarkable spirit crafted to honor the past, celebrate the present, and inspire the future.

“This special Family Reserve release is a tribute to our father, Igor Kogan, inspired by his vision to create something timeless and beautiful – something that brings people together to celebrate life’s most precious moments. This release is more than just whiskey; it’s a story of transformation, growth, and the relentless pursuit of excellence” says Alex and Irina Kogan, Founders of World Whiskey Society. "As we raise our glasses to two decades of AIKO Brands, we invite you to celebrate with us — honoring the past, savoring the present, and toasting to the future.” adds Feliks Shekhtman, Aiko Brands Managing Partner. “Here's to the next 20 years of shared stories, laughter, and extraordinary whisky." 

The Family Reserve is not just a whiskey; it’s a heartfelt tribute to Igor Kogan, the visionary behind AIKO Brands. Born in Kiev, Ukraine, Igor was a man of remarkable talent and unyielding determination. A colonel in the Army, an educator, inventor, poet, musician, PhD, and later a college professor and entrepreneur in the United States, Igor’s life was defined by creativity, intellect, and resilience.

Igor’s dedication to building a strong family legacy and his belief that success can only be achieved through hard work formed the foundation upon which AIKO Brands was established and instilled that passion and values that are being carried on today through his daughter, Irina Kogan, son, Alex Kogan, and son-in-law, Feliks Shekhtman

The Family Reserve is a testament to the art of craftsmanship and mastery. Distilled at a renowned Kentucky distillery, the Family Reserve Cask Proof has been aged for 20 years with a Mash Bill of 74% Corn, 18% Rye, and 8% Malted Barley. A well-aged, luxurious dram with a harmonious balance of fruit, oak, and spice, all elevated by the nuances of roasted peanuts and butterscotch yielding exceptional depth and refinement.

This limited edition release is now available on WWS online shop and at select retailers nationwide for $1,500. For more information about WWS and its exceptional range of rare whiskeys, including this latest release, please visit the World Whiskey Society website.  

To honor Igor’s memory and his unwavering dedication to creating beauty in all things, 100% of the proceeds from the Family Reserve release will be donated to the Lustgarten Foundation. This organization is at the forefront of research and studies on pancreatic cancer, offering hope and advancing treatment for those impacted by this devastating disease.

About World Whiskey Society:

Established in 2020, the World Whiskey Society (WWS) comprises an ultra-premium collection of rare expressions previously unavailable to even the most sophisticated whiskey enthusiasts. WWS scours the globe far and wide with a singular goal in mind – uniqueness – before selecting a distillery partner to join WWS. Or they may choose to release something completely new by finishing small-batch American bourbon in exotic oak barrels from Japan. Whether it is the Classic Collection, the Reserve Collection, the tributes to Doc Holliday, or the Diamond Collection, WWS offers whiskies for everyday enjoyment and moments of celebration.

Media Contact: Sam O’Brien, Colangelo & Partners

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

Former NFL Star Micah Hyde Seeks to Bridge Beer, Hemp Drinks

Former NFL Star Micah Hyde Seeks to Bridge Beer, Hemp Drinks

Taste Radio: As Investors Get More Selective, Grocery Gets More Curated

Taste Radio: As Investors Get More Selective, Grocery Gets More Curated

New RTDs From Mission Craft, Tavern, Boston Beer and More

New RTDs From Mission Craft, Tavern, Boston Beer and More

SPONSORED POST
Functional Hydration Is Quietly Becoming the Premium Sports Drink Tier

Functional Hydration Is Quietly Becoming the Premium Sports Drink Tier

Marketplace

Bulk Tequila - Private Label Tequila

Bulk Tequila - Private Label Tequila

View All|Post a Listing

Featured Jobs

Brand Representative - Miami, FL - Good Boy Vodka

Brand Representative - Miami, FL - Good Boy Vodka

Sales Representative - AZ - Bluebird Hardwater

Sales Representative - AZ - Bluebird Hardwater

State Manager - OH - Good Boy Vodka

State Manager - OH - Good Boy Vodka

Sales Representative - Craft Beverage Brands South San Diego County (Part time) (Contracted, 1099)  - TDG Beverage Sales & Consulting

Sales Representative - Craft Beverage Brands So...

Business Development Specialist - Nantucket Crisps

Business Development Specialist - Nantucket Crisps

Director of Retail - Rasa

Director of Retail - Rasa

View All Jobs|Post a Job

More News

‘Healthy Enough’ Products Dominate 2025 New Product Pacesetters

‘Healthy Enough’ Products Dominate 2025 New Product Pacesetters

New Beverages: GHOST x Bubblicious, Lapo’s, Recess

New Beverages: GHOST x Bubblicious, Lapo’s, Recess

From the Inside Out: The Rise of Functional Gut Health Drinks – Spate Q2 2026 Report

From the Inside Out: The Rise of Functional Gut Health Drinks – Spate Q2 2026 Report

Review: Little Sun Calimocho Shines Bright

Review: Little Sun Calimocho Shines Bright

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Social Media Content Creator & Event Lead - Next In Natural - Next In Natural
  • National Account Manager - Craft Beer Brewer - Craft Beer Brewer
  • Packaging Operator - Hopworks Brewery - Hopworks Brewery
  • Sr Flavor Scientist - Sierra Nevada Brewing Co. - Sierra Nevada Brewing Co.
  • Packaging Technician - Tired Hands Brewing Company - Tired Hands Brewing Company
  • Packaging Lead - pFriem Family Brewers - pFriem Family Brewers
  • Sales Data Analyst - Sun Noodle - Sun Noodle
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Former NFL Star Micah Hyde Seeks to Bridge Beer, Hemp Drinks
  2. Taste Radio: As Investors Get More Selective, Grocery Gets More Curated
  3. New RTDs From Mission Craft, Tavern, Boston Beer and More
  4. ‘Healthy Enough’ Products Dominate 2025 New Product Pacesetters
  5. New Beverages: GHOST x Bubblicious, Lapo’s, Recess
  6. From the Inside Out: The Rise of Functional Gut Health Drinks – Spate Q2 2026 Report
  7. Review: Little Sun Calimocho Shines Bright
  1. American Harvest Vodka to Debut Container Bar at Chicago's Navy Pier Beer Garden This Summer
  2. Mitra9 Launches Neon Berry Limited-Edition Functional Seltzer Inspired by Gaming and Digital Culture
  3. ATLAUA Launches Botanical Recovery Beverage for Athletes
  4. Oishii Sake Signs Alignment Distribution Agreement with Southern Glazer’s Wine & Spirits
  5. Lapo's Expands Its Portfolio with Two New Expressions: Amaro and Amaro Cola
  6. Buffalo Trace Distillery Reintroduces Two Iconic Colonel E.H. Taylor, Jr. Bourbons
  7. Women-Owned Happenstance Whiskey Hits Whole Foods Market Shelves in California
  1. New RTDs From Mission Craft, Tavern, Boston Beer and More
  2. NIQ: No/Low Alcohol Hits $6 Billion Globally, But Soda and Water Are Winning
  3. RNDC Files OR WARN Notices Ahead Of Potential Columbia Deal
  4. BuzzBallz Dominates in Premixed Cocktails as The Segment Hits $2.74B
  5. Perfect Purée Acquires Strongwater, Expands Premium Bar Ingredients Portfolio
  6. Spritz Society Bets the Brand on The Skinny Spritz
  7. NIQ: Hard Tea RTDs Gain On-Premise Share as Spirits & RTDs Lead Growth
  1. Insider’s Week in Beer: ☹️ If You’re Outta Schlitz, You’re Outta Beer
  2. Press Clips: Highland Honors Oscar Wong, Memorial Day’s Importance to Beer and Hints Toward Anchor’s Future
  3. 7 Of Top 10 Craft Brewers Recorded Volume Loss in 2025; Tilray, Athletic & Deschutes Growth Outliers
  4. Heat Check: Trend Tracking as Summer Begins
  5. NIQ: How Moderation Is Reshaping Global Bev-Alc Sales
  6. Numerator: Beer Leads Planned MDW Bev-Alc Buys
  7. NBWA’s Craig Purser Talks Middle-Tier Hot-Button Issues; Aeronaut’s Deepa Chungi Shares the Key to a Successful Events Biz
View All|Submit News

Promoted PR Posts

Franklin & Sons Appoints New Master Importer to Accelerate Growth

Franklin & Sons Appoints New Master Importer to Accelerate Growth

Whale Pod Expands Beyond Shipping with Launch of Custom Printed Can Trays

Whale Pod Expands Beyond Shipping with Launch of Custom Printed Can Trays

Introducing Oath Sparkling Energy + Protein

Introducing Oath Sparkling Energy + Protein

Señorita Broadens Portfolio With 1777, the Brand’s First Non-Alcoholic THC Spirit

Señorita Broadens Portfolio With 1777, the Brand’s First Non-Alcoholic THC Spirit

Vodkade Launches Sugar-Free Line: 90 Calories, Zero Carbs, and No Compromises on Flavor

Vodkade Launches Sugar-Free Line: 90 Calories, Zero Carbs, and No Compromises on Flavor

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙