Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

World Whiskey Society Launches 20-Year-Old Family Reserve Whiskey

PRESS RELEASE posted by World Whiskey Society

Dec. 20, 2024 at 10:39 am

XLinkedInRedditFacebookEmail
Report Press Release
worldwhiskeysocietywhiskeyfamilyreservenewrelease
Spirits Companies
  • image-01

New York, NY - December 20, 2024 - World Whiskey Society (WWS), known for scouring the globe to create the world’s most interesting whiskeys, is proud to announce its latest release: a 20-year-old Family Reserve cask-proof whiskey. 

As AIKO Brands celebrates its 20th anniversary, they reflect on the extraordinary journey that has brought them here – a journey defined by craftsmanship, connection, and the enduring support of a loyal community of wine and spirits enthusiasts. Over two decades, AIKO Brands has grown into a symbol of passion and excellence, uniting people around the world with exceptional wine and spirits.

This year, they’re marking this milestone with something truly extraordinary: the release of the Family Reserve, a whiskey that encapsulates the very essence of their heritage. Aged for 20 years, it is a rare and remarkable spirit crafted to honor the past, celebrate the present, and inspire the future.

“This special Family Reserve release is a tribute to our father, Igor Kogan, inspired by his vision to create something timeless and beautiful – something that brings people together to celebrate life’s most precious moments. This release is more than just whiskey; it’s a story of transformation, growth, and the relentless pursuit of excellence” says Alex and Irina Kogan, Founders of World Whiskey Society. "As we raise our glasses to two decades of AIKO Brands, we invite you to celebrate with us — honoring the past, savoring the present, and toasting to the future.” adds Feliks Shekhtman, Aiko Brands Managing Partner. “Here's to the next 20 years of shared stories, laughter, and extraordinary whisky." 

The Family Reserve is not just a whiskey; it’s a heartfelt tribute to Igor Kogan, the visionary behind AIKO Brands. Born in Kiev, Ukraine, Igor was a man of remarkable talent and unyielding determination. A colonel in the Army, an educator, inventor, poet, musician, PhD, and later a college professor and entrepreneur in the United States, Igor’s life was defined by creativity, intellect, and resilience.

Igor’s dedication to building a strong family legacy and his belief that success can only be achieved through hard work formed the foundation upon which AIKO Brands was established and instilled that passion and values that are being carried on today through his daughter, Irina Kogan, son, Alex Kogan, and son-in-law, Feliks Shekhtman

The Family Reserve is a testament to the art of craftsmanship and mastery. Distilled at a renowned Kentucky distillery, the Family Reserve Cask Proof has been aged for 20 years with a Mash Bill of 74% Corn, 18% Rye, and 8% Malted Barley. A well-aged, luxurious dram with a harmonious balance of fruit, oak, and spice, all elevated by the nuances of roasted peanuts and butterscotch yielding exceptional depth and refinement.

This limited edition release is now available on WWS online shop and at select retailers nationwide for $1,500. For more information about WWS and its exceptional range of rare whiskeys, including this latest release, please visit the World Whiskey Society website.  

To honor Igor’s memory and his unwavering dedication to creating beauty in all things, 100% of the proceeds from the Family Reserve release will be donated to the Lustgarten Foundation. This organization is at the forefront of research and studies on pancreatic cancer, offering hope and advancing treatment for those impacted by this devastating disease.

About World Whiskey Society:

Established in 2020, the World Whiskey Society (WWS) comprises an ultra-premium collection of rare expressions previously unavailable to even the most sophisticated whiskey enthusiasts. WWS scours the globe far and wide with a singular goal in mind – uniqueness – before selecting a distillery partner to join WWS. Or they may choose to release something completely new by finishing small-batch American bourbon in exotic oak barrels from Japan. Whether it is the Classic Collection, the Reserve Collection, the tributes to Doc Holliday, or the Diamond Collection, WWS offers whiskies for everyday enjoyment and moments of celebration.

Media Contact: Sam O’Brien, Colangelo & Partners

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Brewing Available

Contract Brewing Available

View All|Post a Listing

Featured Jobs

Regional Marketing Coordinator - Good Boy Vodka

Regional Marketing Coordinator - Good Boy Vodka

Brewer - Russian River Brewing Company

Brewer - Russian River Brewing Company

Territory Manger - Boston: Suffolk and Norfolk Counties - Lord Hobo Brewing Company

Territory Manger - Boston: Suffolk and Norfolk Cou...

Packaging Specialist - Cerebral Brewing

Packaging Specialist - Cerebral Brewing

Wholesale Sales Representative – Specialty Coffee Inventory - Mochalux

Wholesale Sales Representative – Specialty Coffee ...

Packaging Manager - Guilford Hall Brewery

Packaging Manager - Guilford Hall Brewery

View All Jobs|Post a Job

More News

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

New Beverages: Creatine, Protein, Caffeine and Everything In Between

New Beverages: Creatine, Protein, Caffeine and Everything In Between

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer | Berkeley, CA - Gilman Brewing Company - Gilman Brewing Company
  • Lead Brewer - Smog City Brewing Co. - Smog City Brewing Co.
  • Cellar Operator - Craftsmith Beverage - Craftsmith Beverage
  • Packaging Operator - Craftsmith Beverage - Craftsmith Beverage
  • Director of Sales – Retail - Coast Beacon - Coast Beacon
  • Brewery Operator - 3rd Shift - New Holland Brewing Co. LLC - New Holland Brewing Co. LLC
  • Packaging Operator - Hopworks Brewery - Hopworks Brewery
View AllPost a Job

Recent Articles

  • Newswire
  • Features
  • Spirits
  • Beer
  1. Coca-Cola Consolidated Announces New Partnership Bringing Coca-Cola Products to Kiawah Island Golf Resort
  2. Sazerac Company Continues Investing in Kentucky with Acquisition of Garrard County Distilling
  3. Redwood Empire California Whiskey Announces New Limited-Edition: “The Hyperion”
  4. New Riff Re-releases Sherry-Finished Malted Rye
  5. London Welcomes SANE: London's First Dedicated Sake & Wine Bar
  6. VKTRY Protein Launches The Athlete’s Protein Shot Nationwide at GNC
  7. Himvana Expands Himalayan Herbal Tea Range With Botanical Blends
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. Taste Radio: When Landing Millions Starts With A ‘FirstLook’
  3. 7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart
  4. Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation
  5. New Beverages: Creatine, Protein, Caffeine and Everything In Between
  6. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  7. Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. RTDs Deliver 38% of Bev-Alc Innovation Dollars from Just 22% of Items
  3. Mission Craft Cocktails Rides The Pickle Wave From Prank To New SKU
  4. Diageo Cut 1,900+ Jobs in FY26; 90% of Restructuring to Be Completed by September
  5. YOSHI Is Betting ‘Matchatinis’ Can Repeat Espresso’s Cocktail Success
  6. Sazerac Acquires The UK’s Au Vodka, Adds Another RTD to Portfolio
  7. Adult Non-Alc In 2026: A $1 Billion Category With a Splitting Playbook
  1. Stone Brewing to Lay Off 58 Workers in Mid-October
  2. Press Clips: Increased Brewery Visits, A New Mexico Hermit-Crabbing and Sierra Nevada Agua Azul Spiked Agave Seltzer
  3. Gallup Poll: Record Low Respondents Believe They ‘Drink Too Much;’ Total Drinkers Unchanged from 2025
  4. Boston Beer CFO Diego Reynoso to Exit; Formal Search Launched for Replacement
  5. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  6. NIQ: RTDs Drive 38% of Bev-Alc Innovation Dollars Despite Fewer Items
  7. Great Lakes Bets on Seasonal Variety Packs to Fuel 2026 Growth
View All|Submit News

Promoted PR Posts

Creator-Led Beverage Brand JAZ Energy Sells Out Second Flavor as Founders Prepare Third Launch

Creator-Led Beverage Brand JAZ Energy Sells Out Second Flavor as Founders Prepare Third Launch

Skip Shapiro Enterprises Launches Specialized Website for Beverage Destruction and Sustainable Waste Management

Skip Shapiro Enterprises Launches Specialized Website for Beverage Destruction and Sustainable Waste Management

f'real By Rich's Debuts New Blender and Summer Flavors: Orange Creamsicle Milkshake and Frozen Lemonade

f'real By Rich's Debuts New Blender and Summer Flavors: Orange Creamsicle Milkshake and Frozen Lemonade

Chameleon Coffee Launches Organic A2 Flash Brew RTD Coffee Exclusively at Sprouts Farmers Market

Chameleon Coffee Launches Organic A2 Flash Brew RTD Coffee Exclusively at Sprouts Farmers Market

Circle City Whiskey Co. Celebrates Success as It Expands 50/50 Club Whiskey Program Offering

Circle City Whiskey Co. Celebrates Success as It Expands 50/50 Club Whiskey Program Offering

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase