• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

World Whiskey Society Launches 20-Year-Old Family Reserve Whiskey

info_outline PRESS RELEASE posted by World Whiskey Society

Dec. 20, 2024 at 10:39 am

X LinkedIn Reddit Facebook Email
Report Press Release
worldwhiskeysocietywhiskeyfamilyreservenewrelease
Spirits Companies
  • image-01

New York, NY - December 20, 2024 - World Whiskey Society (WWS), known for scouring the globe to create the world’s most interesting whiskeys, is proud to announce its latest release: a 20-year-old Family Reserve cask-proof whiskey. 

As AIKO Brands celebrates its 20th anniversary, they reflect on the extraordinary journey that has brought them here – a journey defined by craftsmanship, connection, and the enduring support of a loyal community of wine and spirits enthusiasts. Over two decades, AIKO Brands has grown into a symbol of passion and excellence, uniting people around the world with exceptional wine and spirits.

This year, they’re marking this milestone with something truly extraordinary: the release of the Family Reserve, a whiskey that encapsulates the very essence of their heritage. Aged for 20 years, it is a rare and remarkable spirit crafted to honor the past, celebrate the present, and inspire the future.

“This special Family Reserve release is a tribute to our father, Igor Kogan, inspired by his vision to create something timeless and beautiful – something that brings people together to celebrate life’s most precious moments. This release is more than just whiskey; it’s a story of transformation, growth, and the relentless pursuit of excellence” says Alex and Irina Kogan, Founders of World Whiskey Society. "As we raise our glasses to two decades of AIKO Brands, we invite you to celebrate with us — honoring the past, savoring the present, and toasting to the future.” adds Feliks Shekhtman, Aiko Brands Managing Partner. “Here's to the next 20 years of shared stories, laughter, and extraordinary whisky." 

The Family Reserve is not just a whiskey; it’s a heartfelt tribute to Igor Kogan, the visionary behind AIKO Brands. Born in Kiev, Ukraine, Igor was a man of remarkable talent and unyielding determination. A colonel in the Army, an educator, inventor, poet, musician, PhD, and later a college professor and entrepreneur in the United States, Igor’s life was defined by creativity, intellect, and resilience.

Igor’s dedication to building a strong family legacy and his belief that success can only be achieved through hard work formed the foundation upon which AIKO Brands was established and instilled that passion and values that are being carried on today through his daughter, Irina Kogan, son, Alex Kogan, and son-in-law, Feliks Shekhtman

The Family Reserve is a testament to the art of craftsmanship and mastery. Distilled at a renowned Kentucky distillery, the Family Reserve Cask Proof has been aged for 20 years with a Mash Bill of 74% Corn, 18% Rye, and 8% Malted Barley. A well-aged, luxurious dram with a harmonious balance of fruit, oak, and spice, all elevated by the nuances of roasted peanuts and butterscotch yielding exceptional depth and refinement.

This limited edition release is now available on WWS online shop and at select retailers nationwide for $1,500. For more information about WWS and its exceptional range of rare whiskeys, including this latest release, please visit the World Whiskey Society website.  

To honor Igor’s memory and his unwavering dedication to creating beauty in all things, 100% of the proceeds from the Family Reserve release will be donated to the Lustgarten Foundation. This organization is at the forefront of research and studies on pancreatic cancer, offering hope and advancing treatment for those impacted by this devastating disease.

About World Whiskey Society:

Established in 2020, the World Whiskey Society (WWS) comprises an ultra-premium collection of rare expressions previously unavailable to even the most sophisticated whiskey enthusiasts. WWS scours the globe far and wide with a singular goal in mind – uniqueness – before selecting a distillery partner to join WWS. Or they may choose to release something completely new by finishing small-batch American bourbon in exotic oak barrels from Japan. Whether it is the Classic Collection, the Reserve Collection, the tributes to Doc Holliday, or the Diamond Collection, WWS offers whiskies for everyday enjoyment and moments of celebration.

Media Contact: Sam O’Brien, Colangelo & Partners

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

Soft Volumes Lead to Slower Non-Alc Beverage Sales in June

Soft Volumes Lead to Slower Non-Alc Beverage Sales in June

Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado

Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado

YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ

YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ

SPONSORED POST
Connecting Benefits with Flavor to Build Trust in Functional Beverages

Connecting Benefits with Flavor to Build Trust in Functional Beverages

Marketplace

Award Winning Beverage Formulation

Award Winning Beverage Formulation

View All|Post a Listing

Featured Jobs

Brewer - Malibu Brewing Company

Brewer - Malibu Brewing Company

Sales Coordinator - Parker Flavors

Sales Coordinator - Parker Flavors

Sales Rep - Digitally printed cans (New England) - Canworks

Sales Rep - Digitally printed cans (New England...

State Manager - MT/UT/OR - Good Boy Vodka

State Manager - MT/UT/OR - Good Boy Vodka

National Sales Director - Allagash Brewing Company

National Sales Director - Allagash Brewing Company

District Manager - Los Angeles & Central Coast - Coronado Brewing

District Manager - Los Angeles & Central Coast ...

View All Jobs|Post a Job

More News

Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion

Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion

Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead

Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead

Taste Radio: What Did It Take to Make MadeGood Great?

Taste Radio: What Did It Take to Make MadeGood Great?

New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate

New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Packaging Technician - Wilding Brands - Wilding Brands
  • Brewer - Russian River Brewing Comapny - Russian River Brewing Comapny
  • Brewer - Old Schoolhouse Brewery - Old Schoolhouse Brewery
  • Brewer - Stillfire Brewing - Stillfire Brewing
  • Packaging Operator - Tonewood Brewing - Tonewood Brewing
  • Outside Sales Representative - Valor Peak Distillery - Valor Peak Distillery
  • Packaging Manager - Guilford Hall Brewery - Guilford Hall Brewery
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Soft Volumes Lead to Slower Non-Alc Beverage Sales in June
  2. Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado
  3. YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ
  4. Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion
  5. Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead
  6. Taste Radio: What Did It Take to Make MadeGood Great?
  7. New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate
  1. Outlaw Light Beer Broadens Southern California Footprint Through New Partnerships
  2. Lumen Launches Nationwide at Sprouts, Debuting Exclusive Cocolada Flavor of Its Award-Winning Sparkling Protein Drinks
  3. Layn Natural Ingredients to Highlight Monk Fruit Decoction Solutions at IFT FIRST 2026
  4. BioVivo Science Celebrates One Year of Growth, Manufacturing Excellence, and U.S.-Made Botanical Innovation at IFT FIRST
  5. The Spice & Tea Exchange Targets Pennsylvania for Continued Franchise Growth
  6. Maui Brewing Co. Debuts Maui Light NA, a Crisp Non-Alcoholic Brew with a Hint of Lime
  7. Iron Heart Canning Expands to Texas
  1. Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado
  2. Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion
  3. New RTDs From Vodkade, Wild Tide, E-40 and More
  4. Zero Proof Playbook: Soft Bar On What Sustains A Non-Alc Third Space
  5. M&A Activity For Scaled RTD Brands Expected to Ramp Up
  6. Columbia Distributing Adds 850k Cases of Wine and Spirits As RNDC Deal Closes
  7. Hugo’s Cocktails Takes Its Bartender-Crafted RTDs To New Markets
  1. Reyes to Add Sazerac’s Traditional Spirits & RTD Portfolio in Colorado
  2. Brewbound Live Returns to LA This December: Allagash’s Rob Tod & Celine Frueh to Give Keynote Address
  3. YTD 2026 Beverage Performance and Trends – 3 Tier Beverages
  4. Deschutes Plots Post-Costco Lager Strategy as Owned Brands Grow
  5. Top Dog Cocktails Fuels RTD Expansion, Caribbean Distribution With $1.3M Investment In Flamboyant Water
  6. Off-Premise Bev-Alc Sales Reverse Course Before 4th; Spirits, RTDs Remain Bright Spots, per Circana Weekly Scans
  7. World Cup Yet to Combat Accelerated Q2 Declines in Off-Premise, per Bump Williams
View All|Submit News

Promoted PR Posts

So Cool Brands Launches Blueberry & Blood Orange Sports Drinks & Announces Strategic Partnership with The Daley Move Podcast

So Cool Brands Launches Blueberry & Blood Orange Sports Drinks & Announces Strategic Partnership with The Daley Move Podcast

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

Twisted Alchemy Expands at Whole Foods Market, Launches New Products for Summer 2026

Twisted Alchemy Expands at Whole Foods Market, Launches New Products for Summer 2026

Dirty Dill Pickle Vodka Is Scaling Fast — and Inviting Its Community Along for the Ride

Dirty Dill Pickle Vodka Is Scaling Fast — and Inviting Its Community Along for the Ride

PLAYR Launches Performance Nutrition Brand Built Specifically for Youth Athletes

PLAYR Launches Performance Nutrition Brand Built Specifically for Youth Athletes

Hummingbirds Launches Offers, Connecting Creator-Powered Discovery to Verified In-Store Purchases

Hummingbirds Launches Offers, Connecting Creator-Powered Discovery to Verified In-Store Purchases

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙