Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
  • 2026 Awards
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

World Whiskey Society Launches 20-Year-Old Family Reserve Whiskey

PRESS RELEASE posted by World Whiskey Society

Dec. 20, 2024 at 10:39 am

XLinkedInRedditFacebookEmail
Report Press Release
worldwhiskeysocietywhiskeyfamilyreservenewrelease
Spirits Companies
  • image-01

New York, NY - December 20, 2024 - World Whiskey Society (WWS), known for scouring the globe to create the world’s most interesting whiskeys, is proud to announce its latest release: a 20-year-old Family Reserve cask-proof whiskey. 

As AIKO Brands celebrates its 20th anniversary, they reflect on the extraordinary journey that has brought them here – a journey defined by craftsmanship, connection, and the enduring support of a loyal community of wine and spirits enthusiasts. Over two decades, AIKO Brands has grown into a symbol of passion and excellence, uniting people around the world with exceptional wine and spirits.

This year, they’re marking this milestone with something truly extraordinary: the release of the Family Reserve, a whiskey that encapsulates the very essence of their heritage. Aged for 20 years, it is a rare and remarkable spirit crafted to honor the past, celebrate the present, and inspire the future.

“This special Family Reserve release is a tribute to our father, Igor Kogan, inspired by his vision to create something timeless and beautiful – something that brings people together to celebrate life’s most precious moments. This release is more than just whiskey; it’s a story of transformation, growth, and the relentless pursuit of excellence” says Alex and Irina Kogan, Founders of World Whiskey Society. "As we raise our glasses to two decades of AIKO Brands, we invite you to celebrate with us — honoring the past, savoring the present, and toasting to the future.” adds Feliks Shekhtman, Aiko Brands Managing Partner. “Here's to the next 20 years of shared stories, laughter, and extraordinary whisky." 

The Family Reserve is not just a whiskey; it’s a heartfelt tribute to Igor Kogan, the visionary behind AIKO Brands. Born in Kiev, Ukraine, Igor was a man of remarkable talent and unyielding determination. A colonel in the Army, an educator, inventor, poet, musician, PhD, and later a college professor and entrepreneur in the United States, Igor’s life was defined by creativity, intellect, and resilience.

Igor’s dedication to building a strong family legacy and his belief that success can only be achieved through hard work formed the foundation upon which AIKO Brands was established and instilled that passion and values that are being carried on today through his daughter, Irina Kogan, son, Alex Kogan, and son-in-law, Feliks Shekhtman

The Family Reserve is a testament to the art of craftsmanship and mastery. Distilled at a renowned Kentucky distillery, the Family Reserve Cask Proof has been aged for 20 years with a Mash Bill of 74% Corn, 18% Rye, and 8% Malted Barley. A well-aged, luxurious dram with a harmonious balance of fruit, oak, and spice, all elevated by the nuances of roasted peanuts and butterscotch yielding exceptional depth and refinement.

This limited edition release is now available on WWS online shop and at select retailers nationwide for $1,500. For more information about WWS and its exceptional range of rare whiskeys, including this latest release, please visit the World Whiskey Society website.  

To honor Igor’s memory and his unwavering dedication to creating beauty in all things, 100% of the proceeds from the Family Reserve release will be donated to the Lustgarten Foundation. This organization is at the forefront of research and studies on pancreatic cancer, offering hope and advancing treatment for those impacted by this devastating disease.

About World Whiskey Society:

Established in 2020, the World Whiskey Society (WWS) comprises an ultra-premium collection of rare expressions previously unavailable to even the most sophisticated whiskey enthusiasts. WWS scours the globe far and wide with a singular goal in mind – uniqueness – before selecting a distillery partner to join WWS. Or they may choose to release something completely new by finishing small-batch American bourbon in exotic oak barrels from Japan. Whether it is the Classic Collection, the Reserve Collection, the tributes to Doc Holliday, or the Diamond Collection, WWS offers whiskies for everyday enjoyment and moments of celebration.

Media Contact: Sam O’Brien, Colangelo & Partners

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Review: Martinis Are Now Mobile With Write-Off

Review: Martinis Are Now Mobile With Write-Off

Coca-Cola Tests Prebiotic Twist on Its Biggest Brands

Coca-Cola Tests Prebiotic Twist on Its Biggest Brands

KDP Gets Dirty With Soda Innovation, Flavor-Forward Energy SKUs

KDP Gets Dirty With Soda Innovation, Flavor-Forward Energy SKUs

SPONSORED POST
Innovation Moves Fast. Jel Sert Moves Faster. A Century of Proof.

Innovation Moves Fast. Jel Sert Moves Faster. A Century of Proof.

Marketplace

Award Winning Beverage Formulation

Award Winning Beverage Formulation

View All|Post a Listing

Featured Jobs

Packaging Operator - Craftsmith Beverage

Packaging Operator - Craftsmith Beverage

Packaging Technician - Icicle Brewing Company

Packaging Technician - Icicle Brewing Company

Marketing Project Manager - Good Boy Vodka

Marketing Project Manager - Good Boy Vodka

Northeast Market Manager – NY/NJ/CT - Social Hour Cocktails

Northeast Market Manager – NY/NJ/CT - Social Hour ...

Brewer - Aloha Beer

Brewer - Aloha Beer

Regional Sales Manager - Illinois and Missouri Beer and Cider - Stevens Point Brewery Co

Regional Sales Manager - Illinois and Missouri Bee...

View All Jobs|Post a Job

More News

Celsius Reveals Energy+ Hydration Line, Rockstar Rebrand

Celsius Reveals Energy+ Hydration Line, Rockstar Rebrand

THE CPG INSIDER WEEKLY

THE CPG INSIDER WEEKLY

Settlement Reached in FTC’s Price Discrimination Lawsuit Against Southern Glazer’s

Settlement Reached in FTC’s Price Discrimination Lawsuit Against Southern Glazer’s

Hiyo Closes $20.8M Series B as Distribution Footprint Surges

Hiyo Closes $20.8M Series B as Distribution Footprint Surges

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Sales Representative - Sarene Beer Distributors - Sarene Beer Distributors
  • Head Brewer - Finney Hospitality Group - Finney Hospitality Group
  • Senior Beer Sales Representative — NYC & Long Island - Yamada Trading Inc - Yamada Trading Inc
  • Territory Sales Representative – Colorado (Denver Metro) - Pure Madness Group - Pure Madness Group
  • Brewer - Aloha Beer - Aloha Beer
  • Production Brewer I or Production Brewer II - Fort George Brewery - Fort George Brewery
  • Natural Food + Grocery Whole Foods Market Key Account Manager - Austin, TX - Green Spoon Sales - Green Spoon Sales
View AllPost a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. NKD Distillery Turns To Kanna For NAKIES’ Functional Edge
  2. Taste Radio: How Amara Surged From DTC To National Retail
  3. Smartwater Takes Fresh Swing at Sparkling with Latest Innovations
  4. Review: Martinis Are Now Mobile With Write-Off
  5. Coca-Cola Tests Prebiotic Twist on Its Biggest Brands
  6. KDP Gets Dirty With Soda Innovation, Flavor-Forward Energy SKUs
  7. Celsius Reveals Energy+ Hydration Line, Rockstar Rebrand
  1. Maker's Mark Goes Further for Flavor with Its First-Ever Whisky Finished with Japanese Mizunara Oak Staves
  2. H2ALL Is Building More Than Water Projects. It’s Building a Global Community.
  3. The Duckhorn Portfolio Named #21 on Fortune 2026 Best Workplaces in Manufacturing & Production
  4. Buzzard’s Roost Distillery Introduces Newest Expression of Its Popular Cigar Blend Bourbon
  5. Steric Systems Introduces Cost-Effective Solution for Wine Quality Enhancement Amid Early Harvest Challenges
  6. Going Pink.
  7. Cheribundi and Toozi Sleepwear Make Cozy Season Even Sweeter with Limited-Edition Pajama Collaboration
  1. Review: Martinis Are Now Mobile With Write-Off
  2. Settlement Reached in FTC’s Price Discrimination Lawsuit Against Southern Glazer’s
  3. Surfside, Sun Cruiser Drive Prepared Cocktail Gains In Latest NIQ Scans
  4. Martignetti Companies Adds 17 Markets As RNDC Deal Closes
  5. Stateside Brands Projects 4 Million Cases for Super Lyte in Year One
  6. Relaxation At The Center Of $300M Intoxicating Hemp Beverage Business
  7. Breakthru CCO Talks Backing Out of RNDC Deal, Priority Categories
  1. Deschutes Tags Into Hard Sports Drink Segment with Firelyte
  2. Health Claims Pose Potential Regulatory Hurdle for Hard Sports Drink Makers
  3. Accelerated Beer Losses & RTD Slowdown Drive Q3 Downturn in Circana Scans
  4. Brewbound Live 2026: Charting Stone Brewing’s Future in a House of California Brands
  5. Feds’ Southern Glazer’s Bribery Probe Could Serve as ‘Template’ For Future Investigations
  6. Fall Chill Hits Beer Ordering in ‘Contractionary’ September Beer Purchasers’ Index
  7. Insider’s Week in Beer: 🥶 Pop-Tarts Turns Frosty on BuzzBallz Collab
View All|Submit News

Promoted PR Posts

RYTHM Introduces Lifted Lemon, a New THC Twist on Iced Tea and Lemonade

RYTHM Introduces Lifted Lemon, a New THC Twist on Iced Tea and Lemonade

H2Om Water with Intention Hydrates the Stars for The Ed Asner Family Center’s 14th Annual Celebrity Poker Night

H2Om Water with Intention Hydrates the Stars for The Ed Asner Family Center’s 14th Annual Celebrity Poker Night

FORALL takes Flavorless Protein National with Exclusive Sprouts Rollout, Leading with World-First Flavorless Protein Water

FORALL takes Flavorless Protein National with Exclusive Sprouts Rollout, Leading with World-First Flavorless Protein Water

Circle City Whiskey Co. Celebrates Success as It Expands 50/50 Club Whiskey Program Offering

Circle City Whiskey Co. Celebrates Success as It Expands 50/50 Club Whiskey Program Offering

ForceBrands Appoints Brian Waivada as Head of Executive Search

ForceBrands Appoints Brian Waivada as Head of Executive Search

Nirvana Builds a New RTD Lane With Sparkling Coconut Water Cocktails

Nirvana Builds a New RTD Lane With Sparkling Coconut Water Cocktails

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase