• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Crown Royal Unveils Crown Royal Marquis: A Bold New Whisky Crafted For The Next Era Of Nightlife

info_outline PRESS RELEASE posted by Crown Royal

Apr. 30, 2025 at 1:30 pm

X LinkedIn Reddit Facebook Email
Report Press Release
crown royalwhiskywhiskeydrinksspiritsliquor
Spirits Companies
  • image-01
NEW YORK, April 30, 2025 /PRNewswire/ -- Crown Royal announces the release of Crown Royal Marquis Blended Canadian Whisky, the latest innovation in its award-winning portfolio. Finished in Caribbean rum casks and aged to perfection, this distinctive blend is crafted for moments that start as a typical night out and turn unforgettable, reflecting the brand's commitment to crafting exceptional whisky for every occasion.

With rich, inviting notes of honey, brown sugar, and vanilla, and delightful hints of date and fig that give way to a smooth finish, Crown Royal Marquis delivers a complex and versatile flavor. This innovation is crafted for the moments we all crave- the ones that start at the bar and end up on the dance floor sparking spontaneous connections over, live music and good vibes. Whether it's cocktails over dinner that turn into dancing, brunch that becomes a day party or a casual night out that leads to the city's hottest after-parties, Crown Royal Marquis is about celebrating the return of nightlife liveliness.

"Crown Royal Marquis is a very special innovation for the brand, one that truly brings to life our goal of creating exceptional whiskies for every occasion," said Hadley Schafer, VP of Crown Royal. "It's layered flavors and strikingly unique bottle were crafted with everyday royalty in mind, consumers (+21) can enjoy a spirit that makes a delicious cocktail and represents that inviting energy we want to see again in nightlife culture."

To celebrate the debut, Crown Royal Marquis is popping up at Washington DC, and Atlanta's most high-energy events, inviting consumers 21+ to reignite nightlife over bright, elevated cocktails. The liquid is an exceptional expression made to complement the occasions that become Crown Royal Maquis moments. Crown Royal Marquis can be enjoyed neat, on the rocks, or paired with pineapple juice in one of their signature, easy to make cocktails – the Crown Royal Marquis Moment or the Marquis Daquiri.

The Marquis Daiquiri

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky1 oz Pineapple Juice.5 oz Lime Juice.5 oz Simple Syrup

Directions: Add all ingredients into a cocktail shaker and shake vigorously. Strain into a coupe glass and top with dehydrated lime wheel garnish

The Crown Royal Marquis Moment

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky3 oz Pineapple JuiceTop of Club SodaSplash of Lime

Directions: Add all ingredients into a cocktail shaker, add ice. Shake and strain into an ice-filled rocks glass and garnish with dehydrated pineapple.

The Crown Royal Marquis bottle maintains the brands iconic shape, reimagined with luxurious detail. A deep, purple hue paired with signature Crown Royal purple lettering gives the bottle a sleek, elevated finish that mirrors the whisky's bold character. It's a refined take on a classic design, fit for gifting, celebrating or standing out on the shelf.

Crown Royal Marquis will be available beginning May 2025 in Georgia, Maryland, Washington D.C. and select military bases, where spirits-based beverages are sold, for a suggested retail price of $39.99.

For more information about Crown Royal Marquis and to explore the full Crown Royal portfolio, please visit crownroyal.com.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Soft Volumes Lead to Slower Non-Alc Beverage Sales in June

Soft Volumes Lead to Slower Non-Alc Beverage Sales in June

Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado

Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado

YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ

YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ

SPONSORED POST
Connecting Benefits with Flavor to Build Trust in Functional Beverages

Connecting Benefits with Flavor to Build Trust in Functional Beverages

Marketplace

BevSnax - Do you need help with sales in New York State ?

BevSnax - Do you need help with sales in New Yo...

View All|Post a Listing

Featured Jobs

Director of Sales-Texas - Ranch20 Spirits

Director of Sales-Texas - Ranch20 Spirits

National Chain Manager - Pittsburgh Brewing Company

National Chain Manager - Pittsburgh Brewing Com...

Innovations Brewer - Berkeley Yeast

Innovations Brewer - Berkeley Yeast

Area Sales Manager - Pittsburgh, PA - Good Boy Vodka

Area Sales Manager - Pittsburgh, PA - Good Boy ...

Brewer - Shift Brewer - Urban Roots Brewing

Brewer - Shift Brewer - Urban Roots Brewing

Packaging Operator - Tonewood Brewing

Packaging Operator - Tonewood Brewing

View All Jobs|Post a Job

More News

Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion

Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion

Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead

Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead

Taste Radio: What Did It Take to Make MadeGood Great?

Taste Radio: What Did It Take to Make MadeGood Great?

New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate

New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Packaging Technician - Wilding Brands - Wilding Brands
  • Brewer - Russian River Brewing Comapny - Russian River Brewing Comapny
  • Brewer - Old Schoolhouse Brewery - Old Schoolhouse Brewery
  • Brewer - Stillfire Brewing - Stillfire Brewing
  • Packaging Operator - Tonewood Brewing - Tonewood Brewing
  • Outside Sales Representative - Valor Peak Distillery - Valor Peak Distillery
  • Packaging Manager - Guilford Hall Brewery - Guilford Hall Brewery
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Soft Volumes Lead to Slower Non-Alc Beverage Sales in June
  2. Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado
  3. YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ
  4. Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion
  5. Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead
  6. Taste Radio: What Did It Take to Make MadeGood Great?
  7. New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate
  1. Outlaw Light Beer Broadens Southern California Footprint Through New Partnerships
  2. Lumen Launches Nationwide at Sprouts, Debuting Exclusive Cocolada Flavor of Its Award-Winning Sparkling Protein Drinks
  3. Layn Natural Ingredients to Highlight Monk Fruit Decoction Solutions at IFT FIRST 2026
  4. BioVivo Science Celebrates One Year of Growth, Manufacturing Excellence, and U.S.-Made Botanical Innovation at IFT FIRST
  5. The Spice & Tea Exchange Targets Pennsylvania for Continued Franchise Growth
  6. Maui Brewing Co. Debuts Maui Light NA, a Crisp Non-Alcoholic Brew with a Hint of Lime
  7. Iron Heart Canning Expands to Texas
  1. Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado
  2. Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion
  3. New RTDs From Vodkade, Wild Tide, E-40 and More
  4. Zero Proof Playbook: Soft Bar On What Sustains A Non-Alc Third Space
  5. M&A Activity For Scaled RTD Brands Expected to Ramp Up
  6. Columbia Distributing Adds 850k Cases of Wine and Spirits As RNDC Deal Closes
  7. Hugo’s Cocktails Takes Its Bartender-Crafted RTDs To New Markets
  1. Reyes to Add Sazerac’s Traditional Spirits & RTD Portfolio in Colorado
  2. Brewbound Live Returns to LA This December: Allagash’s Rob Tod & Celine Frueh to Give Keynote Address
  3. YTD 2026 Beverage Performance and Trends – 3 Tier Beverages
  4. Deschutes Plots Post-Costco Lager Strategy as Owned Brands Grow
  5. Top Dog Cocktails Fuels RTD Expansion, Caribbean Distribution With $1.3M Investment In Flamboyant Water
  6. Off-Premise Bev-Alc Sales Reverse Course Before 4th; Spirits, RTDs Remain Bright Spots, per Circana Weekly Scans
  7. World Cup Yet to Combat Accelerated Q2 Declines in Off-Premise, per Bump Williams
View All|Submit News

Promoted PR Posts

The Vitamin Shoppe to Add Shakeology by BODi in Retail Locations Nationwide

The Vitamin Shoppe to Add Shakeology by BODi in Retail Locations Nationwide

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

TRIP Makes It Official: This Summer, Find Your Calm in the Chaos with Our New Tropical Mango Flavor

TRIP Makes It Official: This Summer, Find Your Calm in the Chaos with Our New Tropical Mango Flavor

Former Jade Leaf Matcha Founders Launch Mindful Drops for Calm Focus, Nervous System Support & Stress Support

Former Jade Leaf Matcha Founders Launch Mindful Drops for Calm Focus, Nervous System Support & Stress Support

Twisted Alchemy Expands at Whole Foods Market, Launches New Products for Summer 2026

Twisted Alchemy Expands at Whole Foods Market, Launches New Products for Summer 2026

Yah Yah Yah Enters Premium RTD Coffee with Clean-Label, Honey-Sweetened Line

Yah Yah Yah Enters Premium RTD Coffee with Clean-Label, Honey-Sweetened Line

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙