• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Sign Out Manage Account
Sign Out User Short Name
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live
  • Best of 2024 Awards
  • Spirits Awards
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • Content Calendar
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Best of 2025 Awards
      Submit Your Nominations
    • Spirit Awards 2025
      Submit Your Nominations
    • Community Call Topics
      Submit Questions & Topics for Future Calls
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Community Call
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2023 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
    • Supplier Finder
      Database of Suppliers & Service Providers
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Community Call
      Pressing Topics Impacting Businesses
    • Elevator Talk
      Watch Emerging Brands Pitch
    • Category Close-Up
      Dive into Major Food & Beverage Categories
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Crown Royal Unveils Crown Royal Marquis: A Bold New Whisky Crafted For The Next Era Of Nightlife

info_outline PRESS RELEASE posted by Crown Royal

Apr. 30, 2025 at 1:30 pm

X LinkedIn Reddit Facebook Email
Report Press Release
crown royalwhiskywhiskeydrinksspiritsliquor
Spirits Companies
  • image-01
NEW YORK, April 30, 2025 /PRNewswire/ -- Crown Royal announces the release of Crown Royal Marquis Blended Canadian Whisky, the latest innovation in its award-winning portfolio. Finished in Caribbean rum casks and aged to perfection, this distinctive blend is crafted for moments that start as a typical night out and turn unforgettable, reflecting the brand's commitment to crafting exceptional whisky for every occasion.

With rich, inviting notes of honey, brown sugar, and vanilla, and delightful hints of date and fig that give way to a smooth finish, Crown Royal Marquis delivers a complex and versatile flavor. This innovation is crafted for the moments we all crave- the ones that start at the bar and end up on the dance floor sparking spontaneous connections over, live music and good vibes. Whether it's cocktails over dinner that turn into dancing, brunch that becomes a day party or a casual night out that leads to the city's hottest after-parties, Crown Royal Marquis is about celebrating the return of nightlife liveliness.

"Crown Royal Marquis is a very special innovation for the brand, one that truly brings to life our goal of creating exceptional whiskies for every occasion," said Hadley Schafer, VP of Crown Royal. "It's layered flavors and strikingly unique bottle were crafted with everyday royalty in mind, consumers (+21) can enjoy a spirit that makes a delicious cocktail and represents that inviting energy we want to see again in nightlife culture."

To celebrate the debut, Crown Royal Marquis is popping up at Washington DC, and Atlanta's most high-energy events, inviting consumers 21+ to reignite nightlife over bright, elevated cocktails. The liquid is an exceptional expression made to complement the occasions that become Crown Royal Maquis moments. Crown Royal Marquis can be enjoyed neat, on the rocks, or paired with pineapple juice in one of their signature, easy to make cocktails – the Crown Royal Marquis Moment or the Marquis Daquiri.

The Marquis Daiquiri

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky1 oz Pineapple Juice.5 oz Lime Juice.5 oz Simple Syrup

Directions: Add all ingredients into a cocktail shaker and shake vigorously. Strain into a coupe glass and top with dehydrated lime wheel garnish

The Crown Royal Marquis Moment

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky3 oz Pineapple JuiceTop of Club SodaSplash of Lime

Directions: Add all ingredients into a cocktail shaker, add ice. Shake and strain into an ice-filled rocks glass and garnish with dehydrated pineapple.

The Crown Royal Marquis bottle maintains the brands iconic shape, reimagined with luxurious detail. A deep, purple hue paired with signature Crown Royal purple lettering gives the bottle a sleek, elevated finish that mirrors the whisky's bold character. It's a refined take on a classic design, fit for gifting, celebrating or standing out on the shelf.

Crown Royal Marquis will be available beginning May 2025 in Georgia, Maryland, Washington D.C. and select military bases, where spirits-based beverages are sold, for a suggested retail price of $39.99.

For more information about Crown Royal Marquis and to explore the full Crown Royal portfolio, please visit crownroyal.com.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

The Top Ten Most Read Spirits Stories of 2025

The Top Ten Most Read Spirits Stories of 2025

Skinergy Merges Beauty and Energy With Caffeine-Powered Collagen Drink

Skinergy Merges Beauty and Energy With Caffeine-Powered Collagen Drink

Inside the On-Premise Reset: What’s Driving Beverage Growth in 2025 – CGA by NIQ Q4 2025

Inside the On-Premise Reset: What’s Driving Beverage Growth in 2025 – CGA by NIQ Q4 2025

SPONSORED POST
Babe Kombucha’s Hawaiian POG Triumphs at the World Kombucha Awards 2025.

Babe Kombucha’s Hawaiian POG Triumphs at the World Kombucha Awards 2025.

Marketplace

Private Label Drinks in Cans & Bottles - Beverage Specialists - mbabeverage.com

Private Label Drinks in Cans & Bottles - Bevera...

View All|Post a Listing

Featured Jobs

Area Sales Manager - Philadelphia, PA - Good Boy Vodka

Area Sales Manager - Philadelphia, PA - Good Bo...

Area Sales Manager - San Diego County, CA - Good Boy Vodka

Area Sales Manager - San Diego County, CA - Goo...

Territory Director - Blake's Beverage Company

Territory Director - Blake's Beverage Company

Street Team Squad Member - Broward County - Funky Buddha

Street Team Squad Member - Broward County - Fun...

Market Manager - Orange County + Inland Empire / Desert  - Owl's Brew

Market Manager - Orange County + Inland Empire ...

Southern California Craft Beverage Sales Rep & Chain Store Merchandiser's - ABC Distribution Southern California

Southern California Craft Beverage Sales Rep & ...

View All Jobs|Post a Job

More News

Barebells Doubles Down On Protein Drinks

Barebells Doubles Down On Protein Drinks

Taste Radio: Why Uncertainty Could Be CPG’s Biggest Opportunity In 2026

Taste Radio: Why Uncertainty Could Be CPG’s Biggest Opportunity In 2026

Hemp Brand Leaders Talk Battle Plans for 2026

Hemp Brand Leaders Talk Battle Plans for 2026

How to Navigate and Scale Within Independents Retailer Networks

How to Navigate and Scale Within Independents Retailer Networks

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Director of Brewing Operations - Aloha Beer Co. - Aloha Beer Co.
  • Area Sales Manager - MA/RI - Good Boy Vodka - Good Boy Vodka
  • Area Sales Manager - San Diego County, CA - Good Boy Vodka - Good Boy Vodka
  • Senior Brand Manager - Wilding Brands - Wilding Brands
  • Director of Operations - VISTA HERMOSA PRODUCTS LLC - VISTA HERMOSA PRODUCTS LLC
  • Marketing Manager - Leisure Hydration - Leisure Hydration
  • Brewer - Urban Roots Brewing - Urban Roots Brewing
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Skinergy Merges Beauty and Energy With Caffeine-Powered Collagen Drink
  2. Inside the On-Premise Reset: What’s Driving Beverage Growth in 2025 – CGA by NIQ Q4 2025
  3. Casket Maker Goes from Coffins to Caffeine with Energy Drink Launch
  4. Barebells Doubles Down On Protein Drinks
  5. Taste Radio: Why Uncertainty Could Be CPG’s Biggest Opportunity In 2026
  6. Hemp Brand Leaders Talk Battle Plans for 2026
  7. How to Navigate and Scale Within Independents Retailer Networks
  1. Mother Road Brewing Company Introduces Off Road Non-Alcoholic Pale Ale for Dry January
  2. NUDL: Get Your Brain Right
  3. Why Athletes Are Starting the Year Strong with Pickle Juice
  4. What VCs Are Really Looking for in a Prebiotic Soda Brand—Beyond the Hype
  5. BeGOAT Clean Energy Expands Retail Footprint with Fred Meyer Launch and December Promotional Program
  6. NOCK Tequila and Mezcal Expands to Four Major U.S. Markets Following 2025 International Gold Medal Wins
  7. New Ownership Secures Future of San Antonio's Beloved Alamo Beer Company
  1. Stateside Aims to Spark Spiked Sports Drink Trend
  2. Non-Alc Pioneer Spirited Away Acquired By Denizen Rum Founder as Category Matures
  3. ​Clean Alcohol Collective Launches to Push Bev-Alc Transparency
  4. What’s Next for Adult Non-Alc: Bigger Flavors, Tougher Retail, Broader Occasions
  5. BevNET Announces 2025 Spirits Award Winners
  6. Spirits Marketing: WhistlePig Hits Kentucky, Martha and Snoop Are Back
  7. Anheuser-Busch InBev To Acquire Majority Stake in BeatBox
  1. Brewbound Live: Nick Firestone on SKU Rationalization, Returning to the Family Business and 805’s Next Phase
  2. BevNET Live: Hemp Brand Leaders Talk Battle Plans for 2026
  3. Insider’s Week in Beer: 😲 Jim Beam’s Surprising 2026 Resolution
  4. Where Beer Still Wins – and Where It’s Losing Ground: CGA by NIQ Q4 2025
  5. Press Clips: CGA’s Dry January Preview; Jim Beam to Hit 1 Year Production Pause
  6. Total Wine Name Retail Veteran Ryan Ross Next CEO
  7. Brewbound’s Most Listened to Podcast Episodes of 2025
View All|Submit News

Promoted PR Posts

A Look at Whipped Fusion: A Patent-Pending Recipe Shaking Up the Food & Beverage Industry

A Look at Whipped Fusion: A Patent-Pending Recipe Shaking Up the Food & Beverage Industry

You Share a Beer, We Share a Truck: Stone Brewing Partners with Flock Freight to Optimize Shipping with Shared Truckload

You Share a Beer, We Share a Truck: Stone Brewing Partners with Flock Freight to Optimize Shipping with Shared Truckload

BUBBL'R Announces a New Flavor in the Forecast: Fruit Punch'r!

BUBBL'R Announces a New Flavor in the Forecast: Fruit Punch'r!

THC Beverage Pioneer FLORA Rebrands with Functional Ingredients

THC Beverage Pioneer FLORA Rebrands with Functional Ingredients

KUL MOCKS Partners with Sprouts Farmers Market for Exclusive Seasonal Launch of Spiced & Sparkling Mocktails

KUL MOCKS Partners with Sprouts Farmers Market for Exclusive Seasonal Launch of Spiced & Sparkling Mocktails

Highpour Launches Premium THC Seltzers and Margaritas

Highpour Launches Premium THC Seltzers and Margaritas

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
© 1996 – 2025 BevNET.com® Terms of Use Privacy Policy
Back
03/11: Introducing...Nombase! 03/13: Expo West Roundup: Standout Products & Trends from Key Decision Makers 03/20: Growing at Retail: What Does Smart Growth Look Like? 03/27: Smart Demos, Steady Growth. A Cost-Effective Strategy for Retail.
View Community Call Calendar
An error has occurred. This application may no longer respond until reloaded. Reload 🗙