Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Crown Royal Unveils Crown Royal Marquis: A Bold New Whisky Crafted For The Next Era Of Nightlife

PRESS RELEASE posted by Crown Royal

Apr. 30, 2025 at 1:30 pm

XLinkedInRedditFacebookEmail
Report Press Release
crown royalwhiskywhiskeydrinksspiritsliquor
Spirits Companies
  • image-01
NEW YORK, April 30, 2025 /PRNewswire/ -- Crown Royal announces the release of Crown Royal Marquis Blended Canadian Whisky, the latest innovation in its award-winning portfolio. Finished in Caribbean rum casks and aged to perfection, this distinctive blend is crafted for moments that start as a typical night out and turn unforgettable, reflecting the brand's commitment to crafting exceptional whisky for every occasion.

With rich, inviting notes of honey, brown sugar, and vanilla, and delightful hints of date and fig that give way to a smooth finish, Crown Royal Marquis delivers a complex and versatile flavor. This innovation is crafted for the moments we all crave- the ones that start at the bar and end up on the dance floor sparking spontaneous connections over, live music and good vibes. Whether it's cocktails over dinner that turn into dancing, brunch that becomes a day party or a casual night out that leads to the city's hottest after-parties, Crown Royal Marquis is about celebrating the return of nightlife liveliness.

"Crown Royal Marquis is a very special innovation for the brand, one that truly brings to life our goal of creating exceptional whiskies for every occasion," said Hadley Schafer, VP of Crown Royal. "It's layered flavors and strikingly unique bottle were crafted with everyday royalty in mind, consumers (+21) can enjoy a spirit that makes a delicious cocktail and represents that inviting energy we want to see again in nightlife culture."

To celebrate the debut, Crown Royal Marquis is popping up at Washington DC, and Atlanta's most high-energy events, inviting consumers 21+ to reignite nightlife over bright, elevated cocktails. The liquid is an exceptional expression made to complement the occasions that become Crown Royal Maquis moments. Crown Royal Marquis can be enjoyed neat, on the rocks, or paired with pineapple juice in one of their signature, easy to make cocktails – the Crown Royal Marquis Moment or the Marquis Daquiri.

The Marquis Daiquiri

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky1 oz Pineapple Juice.5 oz Lime Juice.5 oz Simple Syrup

Directions: Add all ingredients into a cocktail shaker and shake vigorously. Strain into a coupe glass and top with dehydrated lime wheel garnish

The Crown Royal Marquis Moment

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky3 oz Pineapple JuiceTop of Club SodaSplash of Lime

Directions: Add all ingredients into a cocktail shaker, add ice. Shake and strain into an ice-filled rocks glass and garnish with dehydrated pineapple.

The Crown Royal Marquis bottle maintains the brands iconic shape, reimagined with luxurious detail. A deep, purple hue paired with signature Crown Royal purple lettering gives the bottle a sleek, elevated finish that mirrors the whisky's bold character. It's a refined take on a classic design, fit for gifting, celebrating or standing out on the shelf.

Crown Royal Marquis will be available beginning May 2025 in Georgia, Maryland, Washington D.C. and select military bases, where spirits-based beverages are sold, for a suggested retail price of $39.99.

For more information about Crown Royal Marquis and to explore the full Crown Royal portfolio, please visit crownroyal.com.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Brewing Available

Contract Brewing Available

View All|Post a Listing

Featured Jobs

Craft Manager South West Region - Prairie Malt (Boortmalt)

Craft Manager South West Region - Prairie Malt (Bo...

Assistant Brewer - Lucky Luke Brewing Co

Assistant Brewer - Lucky Luke Brewing Co

Brand Manager - Good Boy Vodka

Brand Manager - Good Boy Vodka

Area Sales Manager - St. Pete, FL - Good Boy Vodka

Area Sales Manager - St. Pete, FL - Good Boy Vodka

Field Sales Representative: New York City  - Lawson's Finest Liquids

Field Sales Representative: New York City - Lawso...

Northeast Market Manager – NY/NJ/CT - Social Hour Cocktails

Northeast Market Manager – NY/NJ/CT - Social Hour ...

View All Jobs|Post a Job

More News

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

New Beverages: Creatine, Protein, Caffeine and Everything In Between

New Beverages: Creatine, Protein, Caffeine and Everything In Between

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer | Berkeley, CA - Gilman Brewing Company - Gilman Brewing Company
  • Lead Brewer - Smog City Brewing Co. - Smog City Brewing Co.
  • Cellar Operator - Craftsmith Beverage - Craftsmith Beverage
  • Packaging Operator - Craftsmith Beverage - Craftsmith Beverage
  • Director of Sales – Retail - Coast Beacon - Coast Beacon
  • Brewery Operator - 3rd Shift - New Holland Brewing Co. LLC - New Holland Brewing Co. LLC
  • Packaging Operator - Hopworks Brewery - Hopworks Brewery
View AllPost a Job

Recent Articles

  • Newswire
  • Features
  • Spirits
  • Beer
  1. Coca-Cola Consolidated Announces New Partnership Bringing Coca-Cola Products to Kiawah Island Golf Resort
  2. Sazerac Company Continues Investing in Kentucky with Acquisition of Garrard County Distilling
  3. Redwood Empire California Whiskey Announces New Limited-Edition: “The Hyperion”
  4. New Riff Re-releases Sherry-Finished Malted Rye
  5. London Welcomes SANE: London's First Dedicated Sake & Wine Bar
  6. VKTRY Protein Launches The Athlete’s Protein Shot Nationwide at GNC
  7. Himvana Expands Himalayan Herbal Tea Range With Botanical Blends
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. Taste Radio: When Landing Millions Starts With A ‘FirstLook’
  3. 7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart
  4. Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation
  5. New Beverages: Creatine, Protein, Caffeine and Everything In Between
  6. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  7. Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. RTDs Deliver 38% of Bev-Alc Innovation Dollars from Just 22% of Items
  3. Mission Craft Cocktails Rides The Pickle Wave From Prank To New SKU
  4. Diageo Cut 1,900+ Jobs in FY26; 90% of Restructuring to Be Completed by September
  5. YOSHI Is Betting ‘Matchatinis’ Can Repeat Espresso’s Cocktail Success
  6. Sazerac Acquires The UK’s Au Vodka, Adds Another RTD to Portfolio
  7. Adult Non-Alc In 2026: A $1 Billion Category With a Splitting Playbook
  1. Sapporo USA to Lay Off 58 in 1st Phase of Stone Escondido Brewery Wind Down
  2. Press Clips: Increased Brewery Visits, A New Mexico Hermit-Crabbing and Sierra Nevada Agua Azul Spiked Agave Seltzer
  3. Gallup Poll: Record Low Respondents Believe They ‘Drink Too Much;’ Total Drinkers Unchanged from 2025
  4. Boston Beer CFO Diego Reynoso to Exit; Formal Search Launched for Replacement
  5. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  6. NIQ: RTDs Drive 38% of Bev-Alc Innovation Dollars Despite Fewer Items
  7. Great Lakes Bets on Seasonal Variety Packs to Fuel 2026 Growth
View All|Submit News

Promoted PR Posts

See the Elephant Amaro Lands in 99 Fine Wine & Good Spirits Stores Across Pennsylvania

See the Elephant Amaro Lands in 99 Fine Wine & Good Spirits Stores Across Pennsylvania

FORM Launches AI POSM Recognition, Giving Food & Beverage Brands Instant Visibility Into In-Store Displays and Promotions

FORM Launches AI POSM Recognition, Giving Food & Beverage Brands Instant Visibility Into In-Store Displays and Promotions

Carabuena Tequila Announces National Growth Initiative

Carabuena Tequila Announces National Growth Initiative

Skip Shapiro Enterprises Launches Specialized Website for Beverage Destruction and Sustainable Waste Management

Skip Shapiro Enterprises Launches Specialized Website for Beverage Destruction and Sustainable Waste Management

Waiakea Hawaiian Volcanic Beverages Marks 14 Years of Sustainable Innovation with the Launch of Pa'a Premium Glass Collection

Waiakea Hawaiian Volcanic Beverages Marks 14 Years of Sustainable Innovation with the Launch of Pa'a Premium Glass Collection

Wipeout Beverages Launches Functional Ready-to-Drink Tea Brand

Wipeout Beverages Launches Functional Ready-to-Drink Tea Brand

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase