Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Dr. Konstantin Frank Winery Celebrates 40 Years of Sparkling Wine Innovation

PRESS RELEASE posted by Dr. Konstantin Frank Winery

Sep. 11, 2025 at 2:24 pm

XLinkedInRedditFacebookEmail
Report Press Release
fingerlakesdrfranksparklingnewyorkwineKonstantinFranksparklingwinedrfrankwineviniferaChateauFrankMethodeChampenoise
Supplier & Service ProviderSpirits Companies
  • image-01

Hammondsport, NY, September 11, 2025 — In 1985, Willy Frank changed the trajectory of East Coast winemaking by releasing the first traditional method sparkling wine in the Eastern United States made from the classic vinifera grapes used in the Champagne region. It was a bold move that introduced a new standard of quality to New York’s Finger Lakes region. Forty years later, that pioneering spirit lives on through a sparkling wine program that remains central to Dr. Konstantin Frank Winery’s identity and legacy.

To mark the milestone this fall, the winery has released Brut 2021 Cuvée 85 (SRP $85), a limited-edition 2021 Brut made from 55% Chardonnay, 40% Pinot Noir, and 5% Pinot Meunier, with a final dosage drawn from the winery’s inaugural 1985 Brut. This rare blend marries the bright energy of the 2021 vintage with the layered complexity of wine aged for nearly four decades, creating a sparkling expression that is both vibrant and deeply nuanced. Only 100 cases produced, Cuvée 85 also marks sparkling winemaker Eric Bauman’s 20th vintage with the winery and is nowavailable online and at the winery.

The roots of the program date back to the 1970s, when Willy Frank, second-generation vintner and son of founder Dr. Konstantin Frank, dreamed of producing sparkling wines in the tradition of Champagne. During that decade, he began planting Chardonnay, Pinot Noir, and Pinot Meunier in the Finer Lakes with a singular goal: to create world-class sparkling wine from vinifera grapes. In 1980, he and his wife Margrit purchased a historic 19th-century stone home and cellar, formerly the Western New York Wine Company, to house the project that became known as Chateau Frank, which is now part of the unified Dr. Konstantin Frank label and home to the winery’s acclaimed 1886 Experience.

“Willy wasn’t afraid to take risks,” says Meaghan Frank, fourth-generation vintner and vice president. “He charged premium prices for these wines before the category even existed in the region, and his belief in their quality never wavered. Today, we’re seeing the fruits of that vision fully realized.”

The traditional method, or méthode champenoise, involves a second fermentation in the bottle and long aging on the lees to develop complexity and finesse. It is the most time- and labor-intensive sparkling winemaking technique, revered for producing wines of exceptional depth.

The Finger Lakes is one of the few regions in North America with the natural attributes to support world-class traditional method sparkling wine. A true cool climate, the growing conditions mirror those of Champagne, with long seasons that preserve acidity and freshness. Glacial till and shale-rich soils, particularly around Keuka Lake, contribute minerality and structure. These attributes allow the wines to age gracefully and maintain vibrancy over time.

Sparkling wine has been central to the winery’s identity for the past four decades. In 2005, the year of Willy Frank’s retirement, the family appointed Eric Bauman as Dr. Konstantin Frank’s dedicated sparkling winemaker. Over the past 20 years, he has preserved the estate’s signature house style—clean, precise, and age-worthy—while expanding the range through modern techniques and limited-production innovations. Under his leadership, and with the continued guidance of longtime consulting sparkling winemaker Barbara Frank, both production and overall quality have continued to rise.  

Today, the winery’s sparkling portfolio includes numerous bottlings. Vintage Brut, Brut Rosé, Blanc de Blanc, Blanc de Noirs, Célèbre Riesling, and Riesling Nature are just a few of the offerings. Dr. Frank’s sparkling wines span a range of sweetness levels and styles. Recent additions include experimental cuvées made from Grüner Veltliner, Pinot Blanc, Saperavi, Rkatsiteli, and Pinot Gris. These wines are part of the Art Series, which showcases innovative work with fermentation vessels like concrete eggs that enhance texture and dimension.

Despite scaling up production, the winery continues to rely on traditional methods. Grapes are hand-harvested, and only the most delicate first pressing (the cuvée) is used. The base wines are fermented traditionally and aged on lees in the estate’s historic underground cellar, originally constructed in the 1800s. Each bottle is riddled, disgorged, corked, and labeled by hand. The month of disgorgement is listed on every label, ensuring transparency and attention to detail.

“Our focus is always on clarity, freshness, and structure,” says Bauman. “We avoid malolactic fermentation to preserve bright acidity and skip oak aging before bottling. The result is a house style that is vibrant, balanced, and built to age.”

“Sparkling wine is in our DNA,” adds Meaghan. “We’ve been doing this for 40 years, and everything we’ve built is based on that foundation. With our vineyards, winemaking expertise, and a dedicated team, we’re excited for what’s ahead.”

To celebrate the momentous occasion, Dr. Konstantin Frank Winery hosted Our Sparkling Legacy: 40 Years of Chateau Frank! on Saturday, August 16 for more than 300 guests. This special event included seminars, guided tastings, and several immersive experiences, honoring the history and future of the Finger Lakes’ pioneering sparkling wine program.

About Dr. Konstantin Frank Winery

Since its establishment in 1962, Dr. Konstantin Frank Winery has been a pioneer in the Finger Lakes wine region. Renowned for introducing European vinifera grape varieties to the eastern U.S., the winery has achieved global acclaim for its innovative approach and exceptional wines. Nestled on the serene Keuka Lake, the vineyards boast some of the oldest vines in the country, including the second-oldest Pinot Noir vines in the U.S. Under the stewardship of the fourth generation of the Frank family, the winery continues to produce a diverse array of premium still and traditional method sparkling wines, all reflecting a profound passion for winemaking and an unwavering dedication to quality. 

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Manufacturing & Packaging Services - Portland, Maine Area

Contract Manufacturing & Packaging Services - Port...

View All|Post a Listing

Featured Jobs

Sales Representative – Los Angeles County - Coronado Brewing

Sales Representative – Los Angeles County - Corona...

Innovation Tech 1 - Sierra Nevada Brewing Co.

Innovation Tech 1 - Sierra Nevada Brewing Co.

Beverage Sales Rep - American Craft Distributors

Beverage Sales Rep - American Craft Distributors

Regional Sales Representative - Chicago - Maplewood Brewing and Distilling

Regional Sales Representative - Chicago - Maplewoo...

Area Sales Manager - New Jersey - Good Boy Vodka

Area Sales Manager - New Jersey - Good Boy Vodka

Territory Manager - Full Sail Brewing Co.

Territory Manager - Full Sail Brewing Co.

View All Jobs|Post a Job

More News

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

New Beverages: Creatine, Protein, Caffeine and Everything In Between

New Beverages: Creatine, Protein, Caffeine and Everything In Between

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer | Berkeley, CA - Gilman Brewing Company - Gilman Brewing Company
  • Lead Brewer - Smog City Brewing Co. - Smog City Brewing Co.
  • Cellar Operator - Craftsmith Beverage - Craftsmith Beverage
  • Packaging Operator - Craftsmith Beverage - Craftsmith Beverage
  • Director of Sales – Retail - Coast Beacon - Coast Beacon
  • Brewery Operator - 3rd Shift - New Holland Brewing Co. LLC - New Holland Brewing Co. LLC
  • Packaging Operator - Hopworks Brewery - Hopworks Brewery
View AllPost a Job

Recent Articles

  • Newswire
  • Features
  • Spirits
  • Beer
  1. Coca-Cola Consolidated Announces New Partnership Bringing Coca-Cola Products to Kiawah Island Golf Resort
  2. Sazerac Company Continues Investing in Kentucky with Acquisition of Garrard County Distilling
  3. Redwood Empire California Whiskey Announces New Limited-Edition: “The Hyperion”
  4. New Riff Re-releases Sherry-Finished Malted Rye
  5. London Welcomes SANE: London's First Dedicated Sake & Wine Bar
  6. VKTRY Protein Launches The Athlete’s Protein Shot Nationwide at GNC
  7. Himvana Expands Himalayan Herbal Tea Range With Botanical Blends
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. Taste Radio: When Landing Millions Starts With A ‘FirstLook’
  3. 7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart
  4. Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation
  5. New Beverages: Creatine, Protein, Caffeine and Everything In Between
  6. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  7. Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. RTDs Deliver 38% of Bev-Alc Innovation Dollars from Just 22% of Items
  3. Mission Craft Cocktails Rides The Pickle Wave From Prank To New SKU
  4. Diageo Cut 1,900+ Jobs in FY26; 90% of Restructuring to Be Completed by September
  5. YOSHI Is Betting ‘Matchatinis’ Can Repeat Espresso’s Cocktail Success
  6. Sazerac Acquires The UK’s Au Vodka, Adds Another RTD to Portfolio
  7. Adult Non-Alc In 2026: A $1 Billion Category With a Splitting Playbook
  1. Sapporo USA to Lay Off 58 in 1st Phase of Stone Escondido Brewery Wind Down
  2. Press Clips: Increased Brewery Visits, A New Mexico Hermit-Crabbing and Sierra Nevada Agua Azul Spiked Agave Seltzer
  3. Gallup Poll: Record Low Respondents Believe They ‘Drink Too Much;’ Total Drinkers Unchanged from 2025
  4. Boston Beer CFO Diego Reynoso to Exit; Formal Search Launched for Replacement
  5. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  6. NIQ: RTDs Drive 38% of Bev-Alc Innovation Dollars Despite Fewer Items
  7. Great Lakes Bets on Seasonal Variety Packs to Fuel 2026 Growth
View All|Submit News

Promoted PR Posts

New Functional Beverage Company Hits the Ground Running

New Functional Beverage Company Hits the Ground Running

f'real By Rich's Debuts New Blender and Summer Flavors: Orange Creamsicle Milkshake and Frozen Lemonade

f'real By Rich's Debuts New Blender and Summer Flavors: Orange Creamsicle Milkshake and Frozen Lemonade

Novo Fogo Names Matt Follis Vice President of Sales

Novo Fogo Names Matt Follis Vice President of Sales

EVEN Brings Total Bar Zero-Proof Solution to Paycor Stadium, Home of the Cincinnati Bengals

EVEN Brings Total Bar Zero-Proof Solution to Paycor Stadium, Home of the Cincinnati Bengals

Ola Mate Expands Into Wegmans Stores Across the Northeast and Mid-Atlantic

Ola Mate Expands Into Wegmans Stores Across the Northeast and Mid-Atlantic

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase