• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Dr. Konstantin Frank Winery Celebrates 40 Years of Sparkling Wine Innovation

info_outline PRESS RELEASE posted by Dr. Konstantin Frank Winery

Sep. 11, 2025 at 2:24 pm

X LinkedIn Reddit Facebook Email
Report Press Release
fingerlakesdrfranksparklingnewyorkwineKonstantinFranksparklingwinedrfrankwineviniferaChateauFrankMethodeChampenoise
Supplier & Service ProviderSpirits Companies
  • image-01

Hammondsport, NY, September 11, 2025 — In 1985, Willy Frank changed the trajectory of East Coast winemaking by releasing the first traditional method sparkling wine in the Eastern United States made from the classic vinifera grapes used in the Champagne region. It was a bold move that introduced a new standard of quality to New York’s Finger Lakes region. Forty years later, that pioneering spirit lives on through a sparkling wine program that remains central to Dr. Konstantin Frank Winery’s identity and legacy.

To mark the milestone this fall, the winery has released Brut 2021 Cuvée 85 (SRP $85), a limited-edition 2021 Brut made from 55% Chardonnay, 40% Pinot Noir, and 5% Pinot Meunier, with a final dosage drawn from the winery’s inaugural 1985 Brut. This rare blend marries the bright energy of the 2021 vintage with the layered complexity of wine aged for nearly four decades, creating a sparkling expression that is both vibrant and deeply nuanced. Only 100 cases produced, Cuvée 85 also marks sparkling winemaker Eric Bauman’s 20th vintage with the winery and is nowavailable online and at the winery.

The roots of the program date back to the 1970s, when Willy Frank, second-generation vintner and son of founder Dr. Konstantin Frank, dreamed of producing sparkling wines in the tradition of Champagne. During that decade, he began planting Chardonnay, Pinot Noir, and Pinot Meunier in the Finer Lakes with a singular goal: to create world-class sparkling wine from vinifera grapes. In 1980, he and his wife Margrit purchased a historic 19th-century stone home and cellar, formerly the Western New York Wine Company, to house the project that became known as Chateau Frank, which is now part of the unified Dr. Konstantin Frank label and home to the winery’s acclaimed 1886 Experience.

“Willy wasn’t afraid to take risks,” says Meaghan Frank, fourth-generation vintner and vice president. “He charged premium prices for these wines before the category even existed in the region, and his belief in their quality never wavered. Today, we’re seeing the fruits of that vision fully realized.”

The traditional method, or méthode champenoise, involves a second fermentation in the bottle and long aging on the lees to develop complexity and finesse. It is the most time- and labor-intensive sparkling winemaking technique, revered for producing wines of exceptional depth.

The Finger Lakes is one of the few regions in North America with the natural attributes to support world-class traditional method sparkling wine. A true cool climate, the growing conditions mirror those of Champagne, with long seasons that preserve acidity and freshness. Glacial till and shale-rich soils, particularly around Keuka Lake, contribute minerality and structure. These attributes allow the wines to age gracefully and maintain vibrancy over time.

Sparkling wine has been central to the winery’s identity for the past four decades. In 2005, the year of Willy Frank’s retirement, the family appointed Eric Bauman as Dr. Konstantin Frank’s dedicated sparkling winemaker. Over the past 20 years, he has preserved the estate’s signature house style—clean, precise, and age-worthy—while expanding the range through modern techniques and limited-production innovations. Under his leadership, and with the continued guidance of longtime consulting sparkling winemaker Barbara Frank, both production and overall quality have continued to rise.  

Today, the winery’s sparkling portfolio includes numerous bottlings. Vintage Brut, Brut Rosé, Blanc de Blanc, Blanc de Noirs, Célèbre Riesling, and Riesling Nature are just a few of the offerings. Dr. Frank’s sparkling wines span a range of sweetness levels and styles. Recent additions include experimental cuvées made from Grüner Veltliner, Pinot Blanc, Saperavi, Rkatsiteli, and Pinot Gris. These wines are part of the Art Series, which showcases innovative work with fermentation vessels like concrete eggs that enhance texture and dimension.

Despite scaling up production, the winery continues to rely on traditional methods. Grapes are hand-harvested, and only the most delicate first pressing (the cuvée) is used. The base wines are fermented traditionally and aged on lees in the estate’s historic underground cellar, originally constructed in the 1800s. Each bottle is riddled, disgorged, corked, and labeled by hand. The month of disgorgement is listed on every label, ensuring transparency and attention to detail.

“Our focus is always on clarity, freshness, and structure,” says Bauman. “We avoid malolactic fermentation to preserve bright acidity and skip oak aging before bottling. The result is a house style that is vibrant, balanced, and built to age.”

“Sparkling wine is in our DNA,” adds Meaghan. “We’ve been doing this for 40 years, and everything we’ve built is based on that foundation. With our vineyards, winemaking expertise, and a dedicated team, we’re excited for what’s ahead.”

To celebrate the momentous occasion, Dr. Konstantin Frank Winery hosted Our Sparkling Legacy: 40 Years of Chateau Frank! on Saturday, August 16 for more than 300 guests. This special event included seminars, guided tastings, and several immersive experiences, honoring the history and future of the Finger Lakes’ pioneering sparkling wine program.

About Dr. Konstantin Frank Winery

Since its establishment in 1962, Dr. Konstantin Frank Winery has been a pioneer in the Finger Lakes wine region. Renowned for introducing European vinifera grape varieties to the eastern U.S., the winery has achieved global acclaim for its innovative approach and exceptional wines. Nestled on the serene Keuka Lake, the vineyards boast some of the oldest vines in the country, including the second-oldest Pinot Noir vines in the U.S. Under the stewardship of the fourth generation of the Frank family, the winery continues to produce a diverse array of premium still and traditional method sparkling wines, all reflecting a profound passion for winemaking and an unwavering dedication to quality. 

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Former NFL Star Micah Hyde Seeks to Bridge Beer, Hemp Drinks

Former NFL Star Micah Hyde Seeks to Bridge Beer, Hemp Drinks

Taste Radio: As Investors Get More Selective, Grocery Gets More Curated

Taste Radio: As Investors Get More Selective, Grocery Gets More Curated

New RTDs From Mission Craft, Tavern, Boston Beer and More

New RTDs From Mission Craft, Tavern, Boston Beer and More

SPONSORED POST
Functional Hydration Is Quietly Becoming the Premium Sports Drink Tier

Functional Hydration Is Quietly Becoming the Premium Sports Drink Tier

Marketplace

Bulk Tequila - Private Label Tequila

Bulk Tequila - Private Label Tequila

View All|Post a Listing

Featured Jobs

Brand Representative - Miami, FL - Good Boy Vodka

Brand Representative - Miami, FL - Good Boy Vodka

Sales Representative - AZ - Bluebird Hardwater

Sales Representative - AZ - Bluebird Hardwater

State Manager - OH - Good Boy Vodka

State Manager - OH - Good Boy Vodka

Sales Representative - Craft Beverage Brands South San Diego County (Part time) (Contracted, 1099)  - TDG Beverage Sales & Consulting

Sales Representative - Craft Beverage Brands So...

Business Development Specialist - Nantucket Crisps

Business Development Specialist - Nantucket Crisps

Director of Retail - Rasa

Director of Retail - Rasa

View All Jobs|Post a Job

More News

‘Healthy Enough’ Products Dominate 2025 New Product Pacesetters

‘Healthy Enough’ Products Dominate 2025 New Product Pacesetters

New Beverages: GHOST x Bubblicious, Lapo’s, Recess

New Beverages: GHOST x Bubblicious, Lapo’s, Recess

From the Inside Out: The Rise of Functional Gut Health Drinks – Spate Q2 2026 Report

From the Inside Out: The Rise of Functional Gut Health Drinks – Spate Q2 2026 Report

Review: Little Sun Calimocho Shines Bright

Review: Little Sun Calimocho Shines Bright

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Social Media Content Creator & Event Lead - Next In Natural - Next In Natural
  • National Account Manager - Craft Beer Brewer - Craft Beer Brewer
  • Packaging Operator - Hopworks Brewery - Hopworks Brewery
  • Sr Flavor Scientist - Sierra Nevada Brewing Co. - Sierra Nevada Brewing Co.
  • Packaging Technician - Tired Hands Brewing Company - Tired Hands Brewing Company
  • Packaging Lead - pFriem Family Brewers - pFriem Family Brewers
  • Sales Data Analyst - Sun Noodle - Sun Noodle
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Former NFL Star Micah Hyde Seeks to Bridge Beer, Hemp Drinks
  2. Taste Radio: As Investors Get More Selective, Grocery Gets More Curated
  3. New RTDs From Mission Craft, Tavern, Boston Beer and More
  4. ‘Healthy Enough’ Products Dominate 2025 New Product Pacesetters
  5. New Beverages: GHOST x Bubblicious, Lapo’s, Recess
  6. From the Inside Out: The Rise of Functional Gut Health Drinks – Spate Q2 2026 Report
  7. Review: Little Sun Calimocho Shines Bright
  1. American Harvest Vodka to Debut Container Bar at Chicago's Navy Pier Beer Garden This Summer
  2. Mitra9 Launches Neon Berry Limited-Edition Functional Seltzer Inspired by Gaming and Digital Culture
  3. ATLAUA Launches Botanical Recovery Beverage for Athletes
  4. Oishii Sake Signs Alignment Distribution Agreement with Southern Glazer’s Wine & Spirits
  5. Lapo's Expands Its Portfolio with Two New Expressions: Amaro and Amaro Cola
  6. Buffalo Trace Distillery Reintroduces Two Iconic Colonel E.H. Taylor, Jr. Bourbons
  7. Women-Owned Happenstance Whiskey Hits Whole Foods Market Shelves in California
  1. New RTDs From Mission Craft, Tavern, Boston Beer and More
  2. NIQ: No/Low Alcohol Hits $6 Billion Globally, But Soda and Water Are Winning
  3. RNDC Files OR WARN Notices Ahead Of Potential Columbia Deal
  4. BuzzBallz Dominates in Premixed Cocktails as The Segment Hits $2.74B
  5. Perfect Purée Acquires Strongwater, Expands Premium Bar Ingredients Portfolio
  6. Spritz Society Bets the Brand on The Skinny Spritz
  7. NIQ: Hard Tea RTDs Gain On-Premise Share as Spirits & RTDs Lead Growth
  1. Insider’s Week in Beer: ☹️ If You’re Outta Schlitz, You’re Outta Beer
  2. Press Clips: Highland Honors Oscar Wong, Memorial Day’s Importance to Beer and Hints Toward Anchor’s Future
  3. 7 Of Top 10 Craft Brewers Recorded Volume Loss in 2025; Tilray, Athletic & Deschutes Growth Outliers
  4. Heat Check: Trend Tracking as Summer Begins
  5. NIQ: How Moderation Is Reshaping Global Bev-Alc Sales
  6. Numerator: Beer Leads Planned MDW Bev-Alc Buys
  7. NBWA’s Craig Purser Talks Middle-Tier Hot-Button Issues; Aeronaut’s Deepa Chungi Shares the Key to a Successful Events Biz
View All|Submit News

Promoted PR Posts

Franklin & Sons Appoints New Master Importer to Accelerate Growth

Franklin & Sons Appoints New Master Importer to Accelerate Growth

Whale Pod Expands Beyond Shipping with Launch of Custom Printed Can Trays

Whale Pod Expands Beyond Shipping with Launch of Custom Printed Can Trays

Introducing Oath Sparkling Energy + Protein

Introducing Oath Sparkling Energy + Protein

Señorita Broadens Portfolio With 1777, the Brand’s First Non-Alcoholic THC Spirit

Señorita Broadens Portfolio With 1777, the Brand’s First Non-Alcoholic THC Spirit

Vodkade Launches Sugar-Free Line: 90 Calories, Zero Carbs, and No Compromises on Flavor

Vodkade Launches Sugar-Free Line: 90 Calories, Zero Carbs, and No Compromises on Flavor

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

MOMOSA Non-Alcoholic Adaptogen-Infused Spritzers Launch at Walmart Across Utah, Arizona, and California

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙