• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Miller Lite Sponsors Free Rides in Milwaukee and the Twin Cities in Celebration of St. Patrick’s Day

info_outline PRESS RELEASE posted by Molson Coors

Mar. 14, 2025 at 11:27 am

X LinkedIn Reddit Facebook Email
Report Press Release
molsoncoorsmillerlitefreeridesstpatricksdaymilwaukeetwincities
Beer CompaniesSpirits Companies
  • image-01

MILWAUKEE – March 4, 2025 – After recently eclipsing 9 million free transit rides provided across the nation since 1988, Molson Coors is activating its 2025 Free Rides program by partnering with the Milwaukee County Transit System (MCTS) and Metro Transit in the Twin Cities for the St. Patrick’s Day holiday.

Revelers in both cities will be able to access fare-free public transportation: from 6 p.m. until the end of service in Milwaukee on Saturday, March 15; and from 6 p.m. until the end of service in the Twin Cities on Monday, March 17.

“We’re incredibly proud to have provided more than 9 million free rides and look forward to the launch of our Free Rides program in 2025,” said Alison Hanrahan, community affairs manager, Molson Coors. “We want residents to feel confident knowing that free rides will be available on Saturday evening in Milwaukee and Monday evening in the Twin Cities, ensuring everyone can get to their destinations with a reliable ride.”

The [SG1] Free Rides program, which began in Milwaukee in 1988, has offered public transit during major holidays and sporting events in a dozen cities[GU2] [SG3] [GU4] [SG5] , underscoring Molson Coors’ commitment to promoting responsible celebrations and serving its hometown communities. While providing free rides in seven cities during New Year’s Eve 2024, Molson Coors eclipsed more than 9 million rides provided in the history of the program.

The 2025 Free Rides program will once again extend nationwide during major holidays and sporting events throughout the year.

In 2024, Molson Coors partnered with local transit in 10 cities to provide fare-free rides on four different occasions. Last year, the program provided more than 30,000 rides in Milwaukee [SG6] [GU7] and the Twin Cities. To help increase access to free rides on St. Patrick’s Day, Metro Transit has also partnered with the Minnesota Valley Transit Authority (MVTA), to provide transportation in the southern portion of the Twin Cities.

Milwaukee and Twin Cities-area residents can visit the MCTS website or the Metro Transit website to review transit routes and make plans for a free ride this St. Patrick’s Day weekend.

About Molson Coors Beverage Company 

For more than two centuries, Molson Coors has brewed beverages that unite people to celebrate all life's moments. From our core power brands Coors Light, Miller Lite, Coors Banquet, Molson Canadian, Carling and Ožujsko to our above premium brands including Madri Excepcional, Staropramen, Blue Moon Belgian White and Leinenkugel's Summer Shandy, to our economy and value brands like Miller High Life and Keystone Light, we produce many beloved and iconic beers. While Molson Coors’ history is rooted in beer, we offer a modern portfolio that expands beyond the beer aisle as well, including flavored beverages like Vizzy Hard Seltzer, spirits like Five Trail whiskey and non-alcoholic beverages like ZOA Energy. As a business, our ambition is to be the first choice for our people, our consumers and our customers, and our success depends on our ability to make our products available to meet a wide range of consumer segments and occasions.  Molson Coors Beverage Company is a publicly traded company that operates through its Americas and EMEA&APAC reporting segments and is traded on the New York Stock Exchange and Toronto Stock Exchange. To learn more about Molson Coors Beverage Company, visit molsoncoors.com.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Soft Volumes Lead to Slower Non-Alc Beverage Sales in June

Soft Volumes Lead to Slower Non-Alc Beverage Sales in June

Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado

Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado

YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ

YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ

SPONSORED POST
Connecting Benefits with Flavor to Build Trust in Functional Beverages

Connecting Benefits with Flavor to Build Trust in Functional Beverages

Marketplace

Award Winning Beverage Formulation

Award Winning Beverage Formulation

View All|Post a Listing

Featured Jobs

Brand Lead  - New Drink brand

Brand Lead - New Drink brand

Los Angeles Field Sales Representative - Allagash Brewing Company

Los Angeles Field Sales Representative - Allaga...

Innovation Tech 1 - Sierra Nevada Brewing Co.

Innovation Tech 1 - Sierra Nevada Brewing Co.

Packaging Operator - Tonewood Brewing

Packaging Operator - Tonewood Brewing

Category Manager - CG Roxane

Category Manager - CG Roxane

Director of Sales-Texas - Ranch20 Spirits

Director of Sales-Texas - Ranch20 Spirits

View All Jobs|Post a Job

More News

Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion

Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion

Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead

Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead

Taste Radio: What Did It Take to Make MadeGood Great?

Taste Radio: What Did It Take to Make MadeGood Great?

New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate

New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Packaging Technician - Wilding Brands - Wilding Brands
  • Brewer - Russian River Brewing Comapny - Russian River Brewing Comapny
  • Brewer - Old Schoolhouse Brewery - Old Schoolhouse Brewery
  • Brewer - Stillfire Brewing - Stillfire Brewing
  • Packaging Operator - Tonewood Brewing - Tonewood Brewing
  • Outside Sales Representative - Valor Peak Distillery - Valor Peak Distillery
  • Packaging Manager - Guilford Hall Brewery - Guilford Hall Brewery
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Soft Volumes Lead to Slower Non-Alc Beverage Sales in June
  2. Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado
  3. YTD 2026 Beverage Performance and Trends – 3Tier Beverages via NIQ
  4. Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion
  5. Mid-Year Snapshot: Promo Pricing Pushes Sports Drinks Ahead
  6. Taste Radio: What Did It Take to Make MadeGood Great?
  7. New Insider Benefit: BevNET & Nosh Data Reports in Partnership with Calebrate
  1. Outlaw Light Beer Broadens Southern California Footprint Through New Partnerships
  2. Lumen Launches Nationwide at Sprouts, Debuting Exclusive Cocolada Flavor of Its Award-Winning Sparkling Protein Drinks
  3. Layn Natural Ingredients to Highlight Monk Fruit Decoction Solutions at IFT FIRST 2026
  4. BioVivo Science Celebrates One Year of Growth, Manufacturing Excellence, and U.S.-Made Botanical Innovation at IFT FIRST
  5. The Spice & Tea Exchange Targets Pennsylvania for Continued Franchise Growth
  6. Maui Brewing Co. Debuts Maui Light NA, a Crisp Non-Alcoholic Brew with a Hint of Lime
  7. Iron Heart Canning Expands to Texas
  1. Sazerac Moves Spirits, RTD Portfolio to Reyes in Colorado
  2. Top Dog Cocktails Makes $1.3M Investment In Flamboyant Water To Fuel RTD, Caribbean Expansion
  3. New RTDs From Vodkade, Wild Tide, E-40 and More
  4. Zero Proof Playbook: Soft Bar On What Sustains A Non-Alc Third Space
  5. M&A Activity For Scaled RTD Brands Expected to Ramp Up
  6. Columbia Distributing Adds 850k Cases of Wine and Spirits As RNDC Deal Closes
  7. Hugo’s Cocktails Takes Its Bartender-Crafted RTDs To New Markets
  1. Reyes to Add Sazerac’s Traditional Spirits & RTD Portfolio in Colorado
  2. Brewbound Live Returns to LA This December: Allagash’s Rob Tod & Celine Frueh to Give Keynote Address
  3. YTD 2026 Beverage Performance and Trends – 3 Tier Beverages
  4. Deschutes Plots Post-Costco Lager Strategy as Owned Brands Grow
  5. Top Dog Cocktails Fuels RTD Expansion, Caribbean Distribution With $1.3M Investment In Flamboyant Water
  6. Off-Premise Bev-Alc Sales Reverse Course Before 4th; Spirits, RTDs Remain Bright Spots, per Circana Weekly Scans
  7. World Cup Yet to Combat Accelerated Q2 Declines in Off-Premise, per Bump Williams
View All|Submit News

Promoted PR Posts

Announcing the U.S. Debut of Castle Freke Irish Gin, the World’s First True Sipping Gin

Announcing the U.S. Debut of Castle Freke Irish Gin, the World’s First True Sipping Gin

Hummingbirds Launches Offers, Connecting Creator-Powered Discovery to Verified In-Store Purchases

Hummingbirds Launches Offers, Connecting Creator-Powered Discovery to Verified In-Store Purchases

Revello Modern Mixers Launches Across Florida with Southern Glazer’s, Introducing a New Standard for Mixers

Revello Modern Mixers Launches Across Florida with Southern Glazer’s, Introducing a New Standard for Mixers

TRIP Makes It Official: This Summer, Find Your Calm in the Chaos with Our New Tropical Mango Flavor

TRIP Makes It Official: This Summer, Find Your Calm in the Chaos with Our New Tropical Mango Flavor

Mingle Mocktails Expands Functional Line with Two Summer SKUs Built on Proven Momentum

Mingle Mocktails Expands Functional Line with Two Summer SKUs Built on Proven Momentum

Aqua Glow Appoints Former Red Bull Executive Daniel Beatty as CEO Following Rapid UK and European Expansion

Aqua Glow Appoints Former Red Bull Executive Daniel Beatty as CEO Following Rapid UK and European Expansion

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙