Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Miller Lite Sponsors Free Rides in Milwaukee and the Twin Cities in Celebration of St. Patrick’s Day

PRESS RELEASE posted by Molson Coors

Mar. 14, 2025 at 11:27 am

XLinkedInRedditFacebookEmail
Report Press Release
molsoncoorsmillerlitefreeridesstpatricksdaymilwaukeetwincities
Beer CompaniesSpirits Companies
  • image-01

MILWAUKEE – March 4, 2025 – After recently eclipsing 9 million free transit rides provided across the nation since 1988, Molson Coors is activating its 2025 Free Rides program by partnering with the Milwaukee County Transit System (MCTS) and Metro Transit in the Twin Cities for the St. Patrick’s Day holiday.

Revelers in both cities will be able to access fare-free public transportation: from 6 p.m. until the end of service in Milwaukee on Saturday, March 15; and from 6 p.m. until the end of service in the Twin Cities on Monday, March 17.

“We’re incredibly proud to have provided more than 9 million free rides and look forward to the launch of our Free Rides program in 2025,” said Alison Hanrahan, community affairs manager, Molson Coors. “We want residents to feel confident knowing that free rides will be available on Saturday evening in Milwaukee and Monday evening in the Twin Cities, ensuring everyone can get to their destinations with a reliable ride.”

The [SG1] Free Rides program, which began in Milwaukee in 1988, has offered public transit during major holidays and sporting events in a dozen cities[GU2] [SG3] [GU4] [SG5] , underscoring Molson Coors’ commitment to promoting responsible celebrations and serving its hometown communities. While providing free rides in seven cities during New Year’s Eve 2024, Molson Coors eclipsed more than 9 million rides provided in the history of the program.

The 2025 Free Rides program will once again extend nationwide during major holidays and sporting events throughout the year.

In 2024, Molson Coors partnered with local transit in 10 cities to provide fare-free rides on four different occasions. Last year, the program provided more than 30,000 rides in Milwaukee [SG6] [GU7] and the Twin Cities. To help increase access to free rides on St. Patrick’s Day, Metro Transit has also partnered with the Minnesota Valley Transit Authority (MVTA), to provide transportation in the southern portion of the Twin Cities.

Milwaukee and Twin Cities-area residents can visit the MCTS website or the Metro Transit website to review transit routes and make plans for a free ride this St. Patrick’s Day weekend.

About Molson Coors Beverage Company 

For more than two centuries, Molson Coors has brewed beverages that unite people to celebrate all life's moments. From our core power brands Coors Light, Miller Lite, Coors Banquet, Molson Canadian, Carling and Ožujsko to our above premium brands including Madri Excepcional, Staropramen, Blue Moon Belgian White and Leinenkugel's Summer Shandy, to our economy and value brands like Miller High Life and Keystone Light, we produce many beloved and iconic beers. While Molson Coors’ history is rooted in beer, we offer a modern portfolio that expands beyond the beer aisle as well, including flavored beverages like Vizzy Hard Seltzer, spirits like Five Trail whiskey and non-alcoholic beverages like ZOA Energy. As a business, our ambition is to be the first choice for our people, our consumers and our customers, and our success depends on our ability to make our products available to meet a wide range of consumer segments and occasions.  Molson Coors Beverage Company is a publicly traded company that operates through its Americas and EMEA&APAC reporting segments and is traded on the New York Stock Exchange and Toronto Stock Exchange. To learn more about Molson Coors Beverage Company, visit molsoncoors.com.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Manufacturing & Packaging Services - Portland, Maine Area

Contract Manufacturing & Packaging Services - Port...

View All|Post a Listing

Featured Jobs

Market Manager SETX - Lady Bird Soda

Market Manager SETX - Lady Bird Soda

Head Brewer | Berkeley, CA - Gilman Brewing Company

Head Brewer | Berkeley, CA - Gilman Brewing Compan...

Social Media Coordinator - Good Boy Vodka

Social Media Coordinator - Good Boy Vodka

Brewer - Old Schoolhouse Brewery

Brewer - Old Schoolhouse Brewery

Pittsburgh Sales Representative - Cinderlands Beer Co.

Pittsburgh Sales Representative - Cinderlands Beer...

Brewer - Civil Society Brewing

Brewer - Civil Society Brewing

View All Jobs|Post a Job

More News

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

New Beverages: Creatine, Protein, Caffeine and Everything In Between

New Beverages: Creatine, Protein, Caffeine and Everything In Between

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer | Berkeley, CA - Gilman Brewing Company - Gilman Brewing Company
  • Lead Brewer - Smog City Brewing Co. - Smog City Brewing Co.
  • Cellar Operator - Craftsmith Beverage - Craftsmith Beverage
  • Packaging Operator - Craftsmith Beverage - Craftsmith Beverage
  • Director of Sales – Retail - Coast Beacon - Coast Beacon
  • Brewery Operator - 3rd Shift - New Holland Brewing Co. LLC - New Holland Brewing Co. LLC
  • Packaging Operator - Hopworks Brewery - Hopworks Brewery
View AllPost a Job

Recent Articles

  • Newswire
  • Features
  • Spirits
  • Beer
  1. Coca-Cola Consolidated Announces New Partnership Bringing Coca-Cola Products to Kiawah Island Golf Resort
  2. Sazerac Company Continues Investing in Kentucky with Acquisition of Garrard County Distilling
  3. Redwood Empire California Whiskey Announces New Limited-Edition: “The Hyperion”
  4. New Riff Re-releases Sherry-Finished Malted Rye
  5. London Welcomes SANE: London's First Dedicated Sake & Wine Bar
  6. VKTRY Protein Launches The Athlete’s Protein Shot Nationwide at GNC
  7. Himvana Expands Himalayan Herbal Tea Range With Botanical Blends
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. Taste Radio: When Landing Millions Starts With A ‘FirstLook’
  3. 7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart
  4. Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation
  5. New Beverages: Creatine, Protein, Caffeine and Everything In Between
  6. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  7. Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. RTDs Deliver 38% of Bev-Alc Innovation Dollars from Just 22% of Items
  3. Mission Craft Cocktails Rides The Pickle Wave From Prank To New SKU
  4. Diageo Cut 1,900+ Jobs in FY26; 90% of Restructuring to Be Completed by September
  5. YOSHI Is Betting ‘Matchatinis’ Can Repeat Espresso’s Cocktail Success
  6. Sazerac Acquires The UK’s Au Vodka, Adds Another RTD to Portfolio
  7. Adult Non-Alc In 2026: A $1 Billion Category With a Splitting Playbook
  1. Sapporo USA to Lay Off 58 in 1st Phase of Stone Escondido Brewery Wind Down
  2. Press Clips: Increased Brewery Visits, A New Mexico Hermit-Crabbing and Sierra Nevada Agua Azul Spiked Agave Seltzer
  3. Gallup Poll: Record Low Respondents Believe They ‘Drink Too Much;’ Total Drinkers Unchanged from 2025
  4. Boston Beer CFO Diego Reynoso to Exit; Formal Search Launched for Replacement
  5. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  6. NIQ: RTDs Drive 38% of Bev-Alc Innovation Dollars Despite Fewer Items
  7. Great Lakes Bets on Seasonal Variety Packs to Fuel 2026 Growth
View All|Submit News

Promoted PR Posts

Costa Rica’s NICOYA Rum Awarded 95 and 93 Points, Both Best Buy, by Wine Enthusiast

Costa Rica’s NICOYA Rum Awarded 95 and 93 Points, Both Best Buy, by Wine Enthusiast

Former PepsiCo Executive Joins THC-Infused Beverage Maker Pharos Brands International as CEO

Former PepsiCo Executive Joins THC-Infused Beverage Maker Pharos Brands International as CEO

Compound Solutions' OnoSweet Featured in On the Brightside, a New Feel-Good Soda for the Golden Hour

Compound Solutions' OnoSweet Featured in On the Brightside, a New Feel-Good Soda for the Golden Hour

Recoup, the First Regenerative Organic Certified Hydration Beverage, Refreshes Brand, Formula, and Packaging

Recoup, the First Regenerative Organic Certified Hydration Beverage, Refreshes Brand, Formula, and Packaging

Ola Mate Expands Into Wegmans Stores Across the Northeast and Mid-Atlantic

Ola Mate Expands Into Wegmans Stores Across the Northeast and Mid-Atlantic

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

15-Year-Old Egypt Dean Turns Kendrick Lamar Royalty Money Into Seven-Figure Investment in Ballislife HYDRO Sports Drink

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase